(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10

ID   PENCW_10; SV 1; linear; genomic DNA; GRV; FUN; 3889175 BP.
XX
AC   AM920428_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c13, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920428.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3889175
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(1739..1792,1871..2392)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947665"
FT                   /orf_name="Pc13g00010"
FT                   /product="Putative uncharacterized protein Pc13g00010 "
FT                   /protein_id="CAP91070.1"
FT                   /db_xref="UniParc:UPI0001830C36"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G9"
FT                   /transl_table=1
FT                   /translation="MALGASVAIPGASTLAFKRPWSQRFQTHHLIIESYTTSSPSEKTK
FT                   CLHKEDQWHCRGPPRYKKKFTEVSRWGGSIIMVLTNIGSDRQHPTQRVEGIINSIYAEM
FT                   SRMQHNYILMLQNRDNMLRAYANDRRAYANENASLEEQNRSLLEHVKSLQRENCSLELK
FT                   HNQQMSEWAKERLQCPEKPDGKRPEGPV"
FT   sig_peptide     1739..1786
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G9 "
FT   mat_peptide     join(1787..1792,1871..2389)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G9 "
FT   CDS_pept        3006..4047
FT                   /pseudo
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT   gap             5862..5961
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(9423..9470),complement(8974..9371),
FT                   complement(8020..8923),complement(7363..7974))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824328"
FT                   /orf_name="Pc13g00030"
FT                   /product="Pc13g00030 protein"
FT                   /protein_id="CAP91072.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001830C37"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H0"
FT                   /transl_table=1
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWAFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLACDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
FT   CDS_pept        12098..13576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977560"
FT                   /orf_name="Pc13g00040"
FT                   /product="Putative uncharacterized protein Pc13g00040 "
FT                   /protein_id="CAP91073.1"
FT                   /db_xref="UniParc:UPI0001830CF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H1"
FT                   /transl_table=1
FT                   /translation="MAESGSGVSQPKAAAADAQASYIQPDSSKGTGAHITNQSQSIQSQ
FT                   SKPPYNTQEEQPSPDGTRETVPGEPNDQPMGDAGSEREPSGSPVAGPRSGHMAENATES
FT                   GSPASVGANDPSDSSDEVLTDLKKLSIGSDRDGEPDAWSRLGRSNVLLVRYGPYKAAKY
FT                   RVQPGNGYNTQGLQKVSKKKTRISCVMYEGEDGEEHYRYSRDNIVGFVGVAFYERKADP
FT                   DKDYKIAPPAFVKVKWQGIDAAHQGLLTRGNSWITKQDLVRLTDLATAEQKISEAWDKQ
FT                   EERHIQWQGQIGRDSPDRSPTPCPLDLFKAQKQERIKRELTIKRELTREPSIPSAQGME
FT                   VDPEGWRLGSRQPAANNTQRLDSVSVKQELDSEDDEDNDLFVDDSSPNARNASDQNTSD
FT                   QNTSGQNTSGQDGNGPNNNGLNNDIRSGSGQNRPPPKLSKFYKRWLRRARIPETDFNNL
FT                   DDAYIGRFEAAAYAYMDELRKQGYVVEDDLGMDI"
FT   CDS_pept        complement(14290..16698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947666"
FT                   /orf_name="Pc13g00050"
FT                   /product="Pc13g00050 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91074.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI0001830CF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H2"
FT                   /transl_table=1
FT                   /translation="MEEVERQLLATKSWKAPGEDGLPAIVWKMTWPVVKHGVLELFQAS
FT                   VDEGTLPKQWRHAKIIPLKKPNKENYTIAKAWRPISLLATLGKVLESVIAERISHAVET
FT                   YGLLPTSHFGARKQRSAEQALLLLQEQIYAAWRGRRVLSLISFDVRGAYNGVCKERLLQ
FT                   RMKARGIPEVLLRWVEAFCSERTATIQINGQASEAQSLPQAGLPQGSPLSPILFLFFNA
FT                   DLVQRQIDGQGGAIAFVDDFTAWVTGPTAQSNRHGIETIINEALDWERRSGATFEADKT
FT                   AIIHFAPKASKLDSEPFTIKGETVEPRDHVKVLGVIMDTRLKYKEHMARAASKGLEAAM
FT                   ELRRLRGQSPATARQLFTSTVAPVVDYASSVWMHAFKNKNIGPINRVQRVGAQAIVGTF
FT                   LTVATSVAEAEAHIATVQHRLWRRAAKTWTDIHTLPATNPLRRSTAQIKKFRRYHRSPL
FT                   YQVADALKSIDMETLETISPFTLAPWEERVQGDGQNVPETQTETGGIMRIAVSSSARNG
FT                   MVGFGVAIEKQPPRYRKPRLKTFSVTLGARIEQNPYSGELAAMAYALGTLRVTLLTSNK
FT                   AAALTLKDPRQQSGQEHICQAYKLIKRLRKHENRINNCWVPTSEDNQLLGLAKEQARTA
FT                   TQEDSTPQAQVPRVKSTTLNISRSQAVPKNCLPENVGKHSKRVDAALPGKHTRQLYDRL
FT                   SWKEASVLAQLRTGMARLNGYLYRINVAESDQCACGQARETVEHFLFRCQRWTTHRTEM
FT                   LQCTHTHRGNISFFLGGKSPLDDQNWKPNLEAVRATIRFAIATGRLDAA"
FT   CDS_pept        complement(17001..17153)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671646"
FT                   /orf_name="Pc13g00060"
FT                   /product="Pc13g00060 protein"
FT                   /protein_id="CAP91075.1"
FT                   /db_xref="UniParc:UPI0001830CF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H3"
FT                   /transl_table=1
FT                   /translation="MDWRYNVTVSIADWALLAGYLVIPGTFTSLKESSQVEEILKTNNA
FT                   GRAVL"
FT   CDS_pept        join(17804..18803,18859..19389,19499..19871,20018..20933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977561"
FT                   /orf_name="Pc13g00070"
FT                   /product="Pc13g00070 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP91076.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001830CFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F7"
FT                   /transl_table=1
FT                   /translation="MAAWLDILSDTTGSSLVDTGRFEEIIQGMSHPNSQYPSLVYFAGN
FT                   GNRIKALQALFPHNNVTRKGPAGLIRAHLSTATAHTEHPVIFAESNPFSQAGVGDSCLL
FT                   RWSGDRHRRYPLALGKSQPLADLQQEVIRHKILPWTQVLCFFVDTASDMRNVQQLLDAP
FT                   TGTLSIGASHIHGMMRVVIVLSGNPQTEAHDADDDFELPSAWLGQHRITVLNIRDRSGL
FT                   SPSVAFDPLRSLVLEQIQETQSLQKEKCLSFSAVHLSALWGRGLQLRMGSSNPANLDCL
FT                   LVAREGYKRKPAMVSCFVELKSQFASSACPENELYNFIASALLLDAYPPGMHLFEPKMV
FT                   FNALYRAYCRNAWEGVDAEIVCNKVLHRFIEGFVQLKSKVSADIRHEALVQFHRRWGGL
FT                   HSTTTCFACMCGPPEHMLPCRHTICDNCVVIYGTKSPRTEYHIDLPKCPICDEAVNLTV
FT                   RQLPPTKGPIVLSLDGGGVRGIVQLGLLRALERRIGGISIAQVADLFAGTSVEESCAKF
FT                   PAFARMIFGSPPKHAPKSPISRCATWIKSLACFLADCQYDSERLEDALQRVVDPQRRMF
FT                   DVTTTSSTGCRVAIITSRTSDGKACVLANYRGMGQREASAAYEFLVPKTADENPHVWKV
FT                   FFRSKSLPGFGALQDGGVRANNPLAIALKESVVIWPSAKTHDLLLSVGTGSFSSVAKPI
FT                   EGASRILQDSAIPRMIRATMSSPCMDGEQGFHEALNFVPDVERSNIFRLNHELPEPLPR
FT                   LDDVSKLEGMSKMHFTVPTELVRTILATAFFFFELDELPIKSQGVFFCKGSVLCSRSYS
FT                   RDLVKLVMVEFPGARFEMARGQRLGDVDDDDGCRVCGYYRKKVGFSINGLHEMTSIGIA
FT                   GSSFFQRIGGFPKSVQELLDDQQANSHFGRADHLVNSWPPKRNCYCSPRVKRHIKFLEP
FT                   ALTHKKRRL"
FT   CDS_pept        22770..23135
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(23386..23775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128673"
FT                   /orf_name="Pc13g00090"
FT                   /product="Putative uncharacterized protein Pc13g00090 "
FT                   /protein_id="CAP91078.1"
FT                   /db_xref="UniParc:UPI0001830CFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F8"
FT                   /transl_table=1
FT                   /translation="MTPTTMMNTNFTQPVECYNSRDAVPATMPSNIQYYNQVPLYQTKS
FT                   PNRDMKAVLQSCCSNVVWIYEDPDPCTAVCDSHTAAEAKKTMYCLNAQMVVYGTKTEKG
FT                   SAVARRPMGWLSLMVGGLRLSGMFI"
FT   CDS_pept        25313..25708
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947667"
FT                   /orf_name="Pc13g00100"
FT                   /product="Pc13g00100 protein"
FT                   /protein_id="CAP91079.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0001830CFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F9"
FT                   /transl_table=1
FT                   /translation="MMRSLFEGYRPTFKPHSLGYEAESLLLLTPSQQMCYYDGKLFGGY
FT                   IALLMDRILADCCKHKHKHKPAFTAYLITSFIHSVPPSAPMLLRAWPEKVEGRKVFLKG
FT                   SVRIPGKSAHDWVDAVRIGALFIRPKP"
FT   CDS_pept        join(complement(28951..29113),complement(27558..27653),
FT                   complement(27279..27388))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128674"
FT                   /orf_name="Pc13g00110"
FT                   /product="Putative uncharacterized protein Pc13g00110 "
FT                   /protein_id="CAP91080.1"
FT                   /db_xref="UniParc:UPI0001830CFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G0"
FT                   /transl_table=1
FT                   /translation="MATTGWDRGLFMLETELCAGSGNEATLDNGEKSTGLRKEVTRLSS
FT                   MPQIGQQSGACPMTGAFADPIRETCLAPSPGNAFAVLAETLSQSPVEIVHANSLEKAKL
FT                   ASLATKHAMPRDQSTDNG"
FT   CDS_pept        join(29153..29324,29378..29922)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128675"
FT                   /orf_name="Pc13g00120"
FT                   /product="Putative uncharacterized protein Pc13g00120 "
FT                   /protein_id="CAP91081.1"
FT                   /db_xref="UniParc:UPI0001830CFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1"
FT                   /transl_table=1
FT                   /translation="MRSFNYLLLIGNVVAGSYLAIIEDNDGENNCRVWSQNNHGCTGYS
FT                   ATFAKLKGKDCSGFIGAGSDDKSVKVDICGTENGEQVAWVTVNKNGTVSFLNRQGDTSS
FT                   CMLENGLKVPSGCSIGNTGSSQTTTPISTASQSSFSTAIGTSTSGTARVDQSPTPTSTS
FT                   TPTDSPSFISDGKSATETPRADQSPTPIFTSTPTDSPSLDLISAGKSATGISLADHSPT
FT                   LTSTPACKCSCESAAV"
FT   sig_peptide     29153..29209
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1 "
FT   mat_peptide     join(29210..29324,29378..29919)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1 "
FT   CDS_pept        join(complement(32363..32506),complement(31944..32303),
FT                   complement(31717..31900),complement(31132..31667),
FT                   complement(30973..31077))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128676"
FT                   /orf_name="Pc13g00130"
FT                   /product="Pc13g00130 protein"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAP91082.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001830CFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G2"
FT                   /transl_table=1
FT                   /translation="MHFILFLILSLAWLANATYIPSLVKVNAADIATRGVNGYRSVAYF
FT                   VNWGIFQPQDIPAEKLTHVLYAFANVRASGEVILSDPWSDTDKHYPTDSWTDTGNNVYG
FT                   CIKKLFLLKKKNRKLKVLLSIGGWTYSSNLRLAFETEAGRQKFAGSSVELLKDLGFDGI
FT                   DVDFEKYPGNNNEADQFVDTLRRLREVFSCFFYLWVCKTKHIQALDVYSYANTGGYHFL
FT                   LTAASPAGPANYLKEHLAQMDRYLDFWNLMAYDYAGSWDTVAGHGANLFASNSNPASTP
FT                   FNTDQAIDYYTSHGVASSNIVLGMPLYGRAFTDTSGPGQPYNGLGVGGWRDGVWDYKAL
FT                   PQTGCKVTNLDQEAASYCYSSGSRLFISYDTPEVARKKGEYIKSKGLGGGMWWELSGDK
FT                   QGDDSLITTVVSTLGGTGALDKTDNQLSYPISKYDNLKACFEP"
FT   mat_peptide     join(complement(32363..32455),complement(31944..32303),
FT                   complement(31717..31900),complement(31132..31667),
FT                   complement(30976..31077))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G2 "
FT   sig_peptide     complement(32456..32506)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G2 "
FT   CDS_pept        complement(33503..33940)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128677"
FT                   /orf_name="Pc13g00140"
FT                   /product="Pc13g00140 protein"
FT                   /protein_id="CAP91083.1"
FT                   /db_xref="UniParc:UPI0001830D00"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G3"
FT                   /transl_table=1
FT                   /translation="MWLIEEQLIEEQLIEERLIEEWLIEEWLIEEWLIEEWLIEEQLIE
FT                   EWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLI
FT                   EEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIE"
FT   CDS_pept        join(34416..34608,34783..34985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671647"
FT                   /orf_name="Pc13g00150"
FT                   /product="Pc13g00150 protein"
FT                   /protein_id="CAP91084.1"
FT                   /db_xref="UniParc:UPI0001830D01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G4"
FT                   /transl_table=1
FT                   /translation="MPPFILSKMPLKAVEHPSADDASSIYSRSPESPKDMLSSMPMMLP
FT                   PRHDLPEINSLDHQIALARVIDVSQELTLQYHFEPEARPLDNERVFQAVRKLRVALEQS
FT                   RIREAQAEQIWKRQWKVSRINHTTRWI"
FT   CDS_pept        join(complement(36595..37270),complement(35597..36573))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671648"
FT                   /orf_name="Pc13g00160"
FT                   /product="Pc13g00160 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91085.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830D02"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G5"
FT                   /transl_table=1
FT                   /translation="MQQPKFLFPSILVLSVTIFYSWITKGIPSRLDANHAPKSRFELVR
FT                   VDSYDFPARAGGIDIIFVHGLGSNPDTTWGARRPQNPLNQTEPTPLNYEQYVNWVKEFL
FT                   PNDLPLEIRKDALYTRLPTIGNNLLEHIDRQIHRSKDEQSRCLIFVGHSYGGLVVKEGW
FT                   LLAYALQPLGSNPLILANLEYDAIQLRDLHEQFIASVRDDLQVVNYYEQRPIRLLKLWL
FT                   FQWQEFTVPESSATYDGKKVSKMGLPVNHYGLNKFESRSESYNSILSKLVKLVTPLLKP
FT                   AKHYYDVLVEIVQTFIQRDQVWEELEEKLQIRYDKASVLYAVTLHGLGGAGKSQLALKY
FT                   AESNTDRYNPILWIDITSEQTGIKKVIPKGTRGRIVITSRDDQSQKLVDRGCEQVRVNI
FT                   MSLREARMVLLRYLSDNIDLVLKTVQKDCDKVAKKLRYLPLAIDLADGLSSRADPYGEN
FT                   ASLGMPAIHNGLGEEDFTKLLILISDTEGEWDDFKYRQSIDVLVRYSLTQRVHGEWPGT
FT                   VMHSLVKWRITKEHYQPEFRQYLILYLPDARDINMTYISRMKIGDIFISTILARVLYDE
FT                   GRWQQAEQLLVQVIETRKAELGEEYPDTLNSIGSLASTFXNQGRWEEAEQLLVXVIETR
FT                   KAKLGEDHPDTLNSMSNLASTYLKQGRLEEAVQLGVQVIGTCKTKLGEDHPDTVYSMGN
FT                   LASTYRNQGWWEEAEXLKVQVMEIRKIKLGDDHPDTLNSMGNLASTFXNQGRXEEAEQL
FT                   LVQVIETRKAKLGEDYPDTLNSIRNLAATYLRQGRXEEAEELLVQVIETRKARLGEDHP
FT                   DTLNSISNLASTYLKGPLRGGRVGVQVIGTCKTKLGEDHPDTLTSISNLASIYRNQGRL
FT                   EEAEQLEIQVMEASKAKLGEDHPDTLSSVSNLAATYLTQGRWEEAEELRVQVIETRKAR
FT                   LGEDHPDTLNSMSNLAFTYRNQGRLEEAEQLEVQVMEASKAKLGADYPDTLNSMSNLAA
FT                   TYLTQGRWEEAEELGVQVIETRKAKLGEDHPDTLNSMGNLAATYLKQGRWEQVEQLLVQ
FT                   VMETHRAKLGEDHPDTLNSMANVASTWKFLGHDAKAIDLLRDCLTKQKQTFGQNHLTTL
FT                   SNSRTLLSWEMESPDYSKRYSKAIDLSTSVGIAAKRMRQAVVNERPGACKYYLQSHYK"
FT   CDS_pept        join(complement(38276..38306),complement(37398..38068))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824329"
FT                   /orf_name="Pc13g00170"
FT                   /product="Pc13g00170 protein"
FT                   /protein_id="CAP91086.1"
FT                   /db_xref="UniParc:UPI0001830D03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G6"
FT                   /transl_table=1
FT                   /translation="MNAVKIGATTRGVSTFRESVPKKVPFRAQHLVLEAVQKMLEQSGF
FT                   RFVQRWLPQACRSAEWVCAESMELHRLFPLLNQNRKYASSKDFHQILAKLHSLRHTVSN
FT                   IRHAAVHRIVQDSESLLEMLQAAVAFASCIGDKECTQQLEFLCSTLNNLLFQMNERLHH
FT                   LQQRVLVQIRICHSRPAELMQRRALLPEAVRRLTEQSEDMFDLQVQGILRKNLLLCWYE
FT                   ASNQPSALQVS"
FT   CDS_pept        join(38747..39148,39205..40218,40283..40510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671649"
FT                   /orf_name="Pc13g00180"
FT                   /product="Pc13g00180 protein"
FT                   /protein_id="CAP91087.1"
FT                   /db_xref="UniParc:UPI0001830D04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7"
FT                   /transl_table=1
FT                   /translation="MASGLEVVGLALAVFPILVEGLKFYADKKGRVRDFIHYRHLLKRI
FT                   VRDLSREQISFQNSSQLFLENISMHYGLSSNDIQEMMQNPQDARWRKGIPFQSDYLIEK
FT                   SVAIYLETVEDMNEVLIKIQDTVGTREGAHPALLDKSTFRRQWRKITLVLGEEDIKKHL
FT                   ERARGLNTFLSQLTEQNKPTSLADSVLQRSTLHYERIRRHAIELFEIFQANLSTSVICK
FT                   CVLGHTVNMKLEFRSARITAKRLFFRTLFTFDRAEPNLTPPYNWREVEIEPLLSARLCH
FT                   ETISHKAVNLFADSSTVQTADSTSSELPNICTVIKGPIQSGWLGYLANSQGCRHRIRVL
FT                   ALDQISAALETIQTISLAAVLDHREFRLVHRYRLGLKLASSVMQLHTTQWLPDYWNKSD
FT                   ISFPCFSDGKIDFNNPLIKRGFGSEEKQNSMAFTSGLSNCGSVPCLFSLGVVLLELIER
FT                   QSIETMKNNSYDDSNTGQVTVELTKRLANSTDCSPNYKKVMKRCIGGLDAAFESLEDGD
FT                   FRDEVEQKIILPLEEDLKFYCDKGYIEDCV"
FT   sig_peptide     38747..38809
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7 "
FT   mat_peptide     join(38810..39148,39205..40218,40283..40507)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7 "
FT   CDS_pept        join(complement(43648..44000),complement(43361..43586),
FT                   complement(43242..43301),complement(42899..43189),
FT                   complement(42617..42845),complement(42151..42560))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128678"
FT                   /orf_name="Pc13g00190"
FT                   /product="Pc13g00190 protein"
FT                   /protein_id="CAP91088.1"
FT                   /db_xref="UniParc:UPI0001830D05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G8"
FT                   /transl_table=1
FT                   /translation="MASKRSHVFRVTGLSRELLDEDLKTTLQETIADKFADDERSHIKA
FT                   EITIVPSCYESDTQRVALVQFRGGVPQFLRELRVDQLGDWQIEMGDDDINFDCHFFGFT
FT                   QLYTPDKNEPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGYN
FT                   SKLSSPGVNTILDYGRELMEDIKKVRTTKQLQQRPLIFIAHSFGGIILAHCLVRAIQTL
FT                   EEDHPAITSLHRATYGIILFAIPHKGLVMDDIQQMLGGDGHHPRETLLRQISSQSDVLI
FT                   HQLADFKNLIRDRKVVSFYETEQTKRLVLDSESGRWKRTGDFMTTVDADSALLQLPDHV
FT                   EDKVPLHADHSMIVKFDMRNAVGYRTALDKLRQFSKKAPSVVAARFNASNAPTTLLHES
FT                   SVRKRNIMDDDSETPKAKRARLHDSASSSNSEESDTAHYEDDNISDDISQVKVYNINEP
FT                   SEESHNGFSESLIARDATSEIGSSFRYGSSSWEGSFSENGLADGSDILEPDELSSSGES
FT                   ISSGC"
FT   CDS_pept        join(complement(45190..46061),complement(44937..45033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671650"
FT                   /orf_name="Pc13g00200"
FT                   /product="Pc13g00200 protein"
FT                   /protein_id="CAP91089.1"
FT                   /db_xref="UniParc:UPI0001830D06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H4"
FT                   /transl_table=1
FT                   /translation="MSAQTETSSMPCPFHKDDQLNGDLDTSLDYLPGHPRIRLGDEKGL
FT                   FEFIRREVWSEDLESISGRLWWMSKQDSSNISPLHRQRVKGRQIIVTEDPRLHLVWIDD
FT                   RIFLKPLPQYITSFVFWDTFMSDPSKLGAAVKLRKAALGYLRTYFYLIQYESDLRIAQD
FT                   PALCLVPKEVTWHRFCQFTARLNDITENEISGRYHYGEIRLTRLNYYAPVLLGKSHYQR
FT                   ENYQYRAYFARIQGPLISAFAFFSIALNCMQVSLAASTSDERYSSALLFAACYWLSTLI
FT                   GFVTGVLMLMLVLKSFLTGDLTEVFSNIDSSVTDFANSTKC"
FT   CDS_pept        complement(46711..48122)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(49646..50001,50063..50288,50464..50754,50811..51039,
FT                   51092..51251,51314..55217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948689"
FT                   /orf_name="Pc13g00220"
FT                   /product="Pc13g00220 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91091.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830DBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H5"
FT                   /transl_table=1
FT                   /translation="MASQRKSHVFRVTGLSRELPDRDLKTAVQRALNDNFTDDERSHIT
FT                   AEVTIVPSCYESDTERAALVQFRGGVPQFLYELRVDPLGDWQVEMGDNDINFDCHFFGF
FT                   TQLYAPDDNEPVVADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMVL
FT                   FAIPHKGLVMDDIQQMLVGDKSHPRERLLQQISSKSDLLIHQLADFKNLIRDRKVVSFY
FT                   ETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDHVEDKVPLHADHSMVVKFDTR
FT                   NAAGYRTAVDKLRQFLKDAPSVVAARFTQTRPKPQPCSTVPFKKDPMFVGRESVISAIN
FT                   ERHRAIGQRHERVALVGLAGVGKTQAAIEYSYRVRESTPDTWVFWIHASNTARLEQGYQ
FT                   QIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLMVLDNADDDGIFFGDNTFNERGPL
FT                   VSFLPQAAHGSMLITSRNGLAARNLVGSDSHVITVQPMNEAESLALLRLRIPAPQSGES
FT                   GESGGDERALVQALECIPLAITQAAAYIANRLPLVTVSAYLRLFHESESKRTRLLQNED
FT                   SADLRRDPSIRYAVMTTWQLSFEQIRQERPAATDLLALMSMFDRQGIPEDLVRHHEQDI
FT                   LDFHDALAPLLSYSLIRLELNERLFDMHRLVQLSVRAWLDMHQQLYGWQAKSRGIMARV
FT                   FPDGEYESWSQCRSLLAHANSVLQSICDVDDKDRLNAAALLSNCGWFLDLQGVYEEAEA
FT                   MHRRALEAREKVLGREHPDTLTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREH
FT                   PNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVNNLGNVLSSQ
FT                   GKYDEAEAMHRRALEGCEEVLGREHPNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGS
FT                   EKVLGREHPHTLASVNNLGNVLSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNN
FT                   LGNVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAM
FT                   HRRDLEGSEKVLGREHPDTFTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREHP
FT                   DTLTSVNNLGLVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTFTSVNNLGDVLSRQG
FT                   KYDEAEAMHRRALEAREKVLGREHPDTLTSVSNLGGVLFSQGKYDEAEAMHRRALEARE
FT                   NVLGREHPNTLTSLSNLGNVLSSQGKYDEAEAMHRRALEARENVLGREHPDTLTSVNNL
FT                   GYILSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNNLGDVLSRQGKYDEAEAMH
FT                   RRALEAREKVLGREHPDTLTSVSNLGDVLSSQGKYDEAEAMHRWALEAREKVLGREHPN
FT                   TLTSVSNFGDVLSSQGKYDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGK
FT                   YDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAMHRRDLEGSEK
FT                   VLGREHPDTFTSVSNLANVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLG
FT                   NVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLGNVLSNQGKYDEAKAIHL
FT                   QDMEGSEKVLGCEHPRILASLNIR"
FT   CDS_pept        join(56357..57123,57198..57969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671895"
FT                   /orf_name="Pc13g00230"
FT                   /product="Pc13g00230 protein"
FT                   /protein_id="CAP91092.1"
FT                   /db_xref="UniParc:UPI0001830DBF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H6"
FT                   /transl_table=1
FT                   /translation="MIASGELIPFDTQTSDSETETSKSGLGKVREETQYEDGDDIELDE
FT                   YIIDIRHIVTSLSVFHFLDYSGVFNRGSYRFVSTLENPAGNDKSFTDYNGPSLSETGCF
FT                   PRHPSTRTRVNKILAEPIGLASGLQALAKFAFQCSTTLHETVNSFRSHYKPVRGLLEEL
FT                   EALSAVLGPLAEFVTSTADIDMSALDLPLLRCGSACKGFQQEILQLSSRSDKGQPNFQD
FT                   WARLKYMDDDIDGFQTMLAGYKATFNIALADANLRQSSVNTEILDDYKRLIQNTEVDLE
FT                   DRLKIIDSKLECIVEKSVTQSEPGAAELQYMKEERLSTEKCLQICAQLSDHIDHIQLMS
FT                   DGGGASHHPDTLGIPPETVTNESLQECKNNLSLTAARLEKHMQDTMNRQLSRPNTATSS
FT                   KIDEEDLTRLQDGCITAQQCLDICSKADSHLKDNDNVIEDYGPGDGSKFKVSTYGDVLH
FT                   AKTRAHGWRTQQLGGYRSEDTVQRLSRDIATINMSHLDGGEPHSTDRRPLDECD"
FT   CDS_pept        58754..59734
FT                   /pseudo
FT                   /gene_family="HOG000234604" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(59920..61287)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824587"
FT                   /orf_name="Pc13g00250"
FT                   /product="Pc13g00250 protein"
FT                   /protein_id="CAP91094.1"
FT                   /db_xref="UniParc:UPI0001830DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H8"
FT                   /transl_table=1
FT                   /translation="MINHSFSNCDESQAQDLDPSDQDSQYAPTPGYYVHTPPSEYGFSP
FT                   SPNRCPHDGAEPLLSTPAETSKLLQLSEWEANRPDDELPASFIRYTIEWKVKVNNRSIS
FT                   EDTEQDVALTPSAYWPLILRDKLYKVIEEKVARKRRVRSDDTSIVVSINDRKQRDLKKR
FT                   FNGLNIDWSAVEKQILVWGKFHASGKELRLKIIFSYIEDDHSPRSATGRNDKRGKSSVT
FT                   KRMLNERDEQLDAEQHATGEQSIWRAVYTLMRCPSPSCHLGPHCWQDPHGKKHYQLRTH
FT                   HLKRLITYVEGGGILECQDDVPDAVREELFLEEQQKVERLRSKGNKMLAAGNCPPISIN
FT                   FMGGQHHLQSPAANSIVTSANSPPQHGQTADPLIIDGPRDLAVREYSAWQETNVVDDNL
FT                   KAQFRQACDVTLANGLDLEQIHEDHDAGFFIEKGVAVGIARRFVSDISRWVRHVRN"
FT   CDS_pept        join(62431..62649,62706..62858)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824588"
FT                   /orf_name="Pc13g00260"
FT                   /product="Pc13g00260 protein"
FT                   /protein_id="CAP91095.1"
FT                   /db_xref="UniParc:UPI0001830DC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H9"
FT                   /transl_table=1
FT                   /translation="MAPVESPIKQEQLRKRRIKQEQLRKRRNNLLRRHNDFWRLYSIKS
FT                   WVVMEMPNGRLYTYYSHPDVAVPTKQEIAQRPQPAVHKSPPDYGPHESANEAIPKLPAI
FT                   TVLGRCNELWSTLSHYITR"
FT   CDS_pept        join(64208..64216,64262..64361,64411..64622,64681..64765,
FT                   64978..65000,65070..65122,65198..65267,65476..65773,
FT                   65850..66010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948690"
FT                   /orf_name="Pc13g00270"
FT                   /product="Pc13g00270 protein"
FT                   /protein_id="CAP91096.1"
FT                   /db_xref="UniParc:UPI0001830DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H175"
FT                   /transl_table=1
FT                   /translation="MSQILDGLCYLSSFGLTHQSLSCGGILLGTNGRVKIACLDQCSEC
FT                   SPTETYTIYANTIPRITMALMQKHEKDVGIAGVNDLNQWPVDSDAFGFLSAASTEPIES
FT                   LRKHPLVAARNQPTEDLVMLARAVLCAWVSKMHITLAIIPSGHEYVYIHCVPPVAIFLF
FT                   RDYHVRLAVHYLGSLEQSHYIVNKWNRTINDLCTQVTKWSLVKANNTVLEEILRRDRIL
FT                   RRNPEQSQRSAGSPFPLESAEEPAISTPPQVDAGSLDGMAIETQRTDAQASASKRGAGT
FT                   RNFLKHKAWPAEVLKRLPLWFEDQVRKNQSQEELMQSVAPSMLSVVSIRLVDGKR"
FT   CDS_pept        join(complement(68009..68143),complement(67448..67856),
FT                   complement(67232..67398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948691"
FT                   /orf_name="Pc13g00280"
FT                   /product="Putative uncharacterized protein Pc13g00280 "
FT                   /protein_id="CAP91097.1"
FT                   /db_xref="UniParc:UPI0001830DC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H176"
FT                   /transl_table=1
FT                   /translation="MDHTDKRKASFYDLSQEILESIAIFTFLITYISVRFAVGHGLCSA
FT                   VENLVQLGASLKHIPCGDMVERAARSHNYKKLLSWLIDHGASFREVQGGIDRLCCEAYE
FT                   QGDFERFRWLFSKGASLDVLAGVVFDFSGCHRPRSREACRYHLLPLKRALREGAKPSGS
FT                   HEALTAELRLRRHKGLGDGEAWHSASKHVILPSDRVVEELCCQASRSSRARIQFYHLAD
FT                   IGKKGPSRRFMINP"
FT   CDS_pept        complement(68187..68587)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(69321..69528,69596..69822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977820"
FT                   /orf_name="Pc13g00300"
FT                   /product="Pc13g00300 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP91099.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI0001830DC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H177"
FT                   /transl_table=1
FT                   /translation="MSTYLSAESIRAIESILNYEFHDKSLLDKAFEAPGATEARGGHQR
FT                   QALIGDAALKLVLTELGYEGNASTGEITISRGSRVSNENLKRLGESLGLNAYFRLNPAS
FT                   QGVVPRSMMATTMEAIIGAVYLDSGKDMATTRALVNRLGI"
FT   CDS_pept        70798..72890
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        73662..74771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824589"
FT                   /orf_name="Pc13g00320"
FT                   /product="Putative uncharacterized protein Pc13g00320 "
FT                   /protein_id="CAP91101.1"
FT                   /db_xref="UniParc:UPI0001830DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H178"
FT                   /transl_table=1
FT                   /translation="MVCLARFERAWLLRSLYSQSQRTLSNTVTTSDVKAPKATSFLQST
FT                   TLYPSSPTAQSWTSPLRSFPPETDIDTPTLTYPGTHTTTSEKENGIIEYLKVDDELGGS
FT                   GLIVEEQSSRTLLPFSLVEDEFAKAANGGARLSQYTVSSVDSDHDFTGSSEFVVYVPSD
FT                   QATLHQPAEVTSMKSSSSTGVFQSLSGQTSVGFSNRGTLPGTLGAVSRSKQKEIGSYVT
FT                   VNLEYSSHLFGNSRHHQPTQTTRNPPKFDDLDLSTLNPITKSQPMDSTKTVPATTTATK
FT                   NTVEQLGTDGSDASRVLSSHGVAVILGSISGASLLFAIIFYLHRFYFRRISTSSRGTGS
FT                   VTQPKADNPAATCPDMSEILEISRFSADS"
FT   CDS_pept        join(complement(79993..80830),complement(78419..79654),
FT                   complement(75794..78262))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(81729..81949),complement(81557..81660),
FT                   complement(81382..81401))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948692"
FT                   /orf_name="Pc13g00340"
FT                   /product="Putative uncharacterized protein Pc13g00340 "
FT                   /protein_id="CAP91103.1"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI0001830DC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H179"
FT                   /transl_table=1
FT                   /translation="MRLGFLLSLFLNVVIARAGLSPVRTVCEFDWSLCQASNNGEMTCF
FT                   CDSDKQNQSTIDLNDCFVNLDGDLSPRQNGGFMDSCGELSFMPALPTLRATCKPNNQIT
FT                   SINMGPDLKL"
FT   mat_peptide     join(complement(81729..81895),complement(81557..81660),
FT                   complement(81385..81401))
FT                   /db_xref="UniProtKB/TrEMBL:B6H179 "
FT   sig_peptide     complement(81896..81949)
FT                   /db_xref="UniProtKB/TrEMBL:B6H179 "
FT   CDS_pept        join(82534..82708,82894..83639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977821"
FT                   /orf_name="Pc13g00350"
FT                   /product="Putative uncharacterized protein Pc13g00350 "
FT                   /protein_id="CAP91104.1"
FT                   /db_xref="UniParc:UPI0001830DC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H180"
FT                   /transl_table=1
FT                   /translation="MMKPQDNYCQLLMPQNYLYTIKHGIPQGGLAVIATFIFWSTARRV
FT                   ANAHRTSQYYRAKILLKTFPWKPVTPYRAPKQNPMDSVTPRKKDNEDHSVFLSSVAPIE
FT                   LSLTTSLQLPKEASNVGIPELDARGLSKQNNLETTFPQWQTKRAVHSKRENESTLHRTS
FT                   EKRTENSCRRNRVRKSSLGQHGSKASQCISSASFKNRTLSKAMKLGPITYRGALKMTGK
FT                   LCKAQLPLLKNHFRDRSDLFSDGEALLHEIATVHPKYNQIIQTLPILLNFIPGELKEKL
FT                   MIEENAEWLKMGAYLVNKWISRSQA"
FT   CDS_pept        join(complement(86825..87239),complement(86467..86771),
FT                   complement(84895..86421))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824590"
FT                   /orf_name="Pc13g00360"
FT                   /product="Pc13g00360 protein"
FT                   /protein_id="CAP91105.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001830DC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H181"
FT                   /transl_table=1
FT                   /translation="MTRLTQAQVEEAEYKVFTYREEHFKMAARVDISRLVFDKNFKRQM
FT                   SNRQNIARLERILDTQGCQRLMEECHVPVLIPESDWQRRVRPRLVDGQFHQLDVDIDYQ
FT                   LRGQDHENLIIAARKKLSSSNSWWIVDVYVTGQTAGEEPLQEEFVRSLRERFPNDQRPP
FT                   DGLIYERIRYYEGYLDGPVNRIAANHWWAALERVPGSKKGKYLRAFLKHPTLPQAFDEL
FT                   LPIAGIWEGMRIGLLHKLFSKPHDQKAKWTYQPLLCYLNHIKSTFFGLMGDRRDLLAQL
FT                   DGVTIQLLKSRVPKVSARDLRFLENRMSKEELFPDIEGVQDRTEIWERLKEIQYPIPTL
FT                   ETFFKDRISLEVGRSVLQQLYIPDPHRKMTVDEELGERYYTSVPVMTSNRQQGIRGDLY
FT                   DFWRFSFQYGFEMTDHKRRTRTKPGTQLAPTPMEELHERQKLWQHLFWLVREKGFSTPL
FT                   VDGLPAHPVELSPITPCDYPASVEEDLPVERRNGTPYKDSMEADHFALSREVLERPWSS
FT                   PRVTAGFARRSVFLAYFRYLKVENGSQSIPEVETNEAVPQEPSLWNPSFDDLIQNTIIP
FT                   PEENEATVFPVFSTPQFDPTSLAPAGDIQPPSRFSMKFIIPGEPDKVVLLPNIQSALNK
FT                   FFEGFSRYHFHIYSGDNPTRGIYGRDCYSLYLGNPFLLLHAEYIGADLSETVFHGSTDQ
FT                   QETRTTKKRRLNENEQGELISAKEWLNASLDELTQEIPENRVDMDLPGGEDSIT"
FT   CDS_pept        88107..>88580
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824591"
FT                   /orf_name="Pc13g00370"
FT                   /product="Pc13g00370 protein"
FT                   /protein_id="CAP91106.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001830DC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H182"
FT                   /transl_table=1
FT                   /translation="MDGIDVANKASSEANSVMNSASTAVIYASGAAETAASQVTDKIQS
FT                   LSDEINSHLPGFYSVGLWGYCQGQKETSSYSNCSQPSTSFSFDLLSILGSASPVIDGIL
FT                   PDGNNKVLAGYHGVSRWSISAYILGFVSTFVAVVFGVTTMFFSWGKILLIISSL"
FT   CDS_pept        complement(90182..90601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948693"
FT                   /orf_name="Pc13g00380"
FT                   /product="Putative uncharacterized protein Pc13g00380 "
FT                   /protein_id="CAP91107.1"
FT                   /db_xref="UniParc:UPI0001830DCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H183"
FT                   /transl_table=1
FT                   /translation="MEEIVDIVRQIGRQQGENVYFRTCYALFKHLQDKAEQASQDLLHL
FT                   HQSGAFGSSDDEFYPVYQVAQELQVSVHELAEQALKAQLACEEFCQLDPSYSAREAFKF
FT                   TDTVHTAGKTEADASQGVCDSPRSMRFIMLPVNDL"
FT   CDS_pept        join(93499..93546,93598..93995,94046..94949,94995..95606)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948694"
FT                   /orf_name="Pc13g00390"
FT                   /product="Pc13g00390 protein"
FT                   /protein_id="CAP91108.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001830DCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H184"
FT                   /transl_table=1
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWVFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLAFDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
FT   CDS_pept        join(complement(101204..101767),complement(100869..101129),
FT                   complement(100436..100619),complement(100088..100213),
FT                   complement(99639..100003))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948695"
FT                   /orf_name="Pc13g00400"
FT                   /product="Pc13g00400 protein"
FT                   /protein_id="CAP91109.1"
FT                   /db_xref="UniParc:UPI0001830DCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H168"
FT                   /transl_table=1
FT                   /translation="MPPTGSKWYRWIADTSLPNLYAISAAIILAICLIYWLARDVSLWM
FT                   WTRHHVVFLFPFRSRMLGSWRRLAFVHLPKCLHWLDIPNYREALILAVMLAANIVGLRL
FT                   RAHSWAEAQKRAGSLAVINLVPLCTGISFGLPADLLHVDRQMLAWFHRWIGRICVLHSL
FT                   FHCSLLVAAARTMNLVTPRHIFPIAALVLVIPVTCAAVQRRYLQFAMKCHYLLAATAIG
FT                   TLIYHLVERRSLYRWYLVGAICLWFFISAVVCIMAAWNQKPWGSSQKEVVMNSILGPYG
FT                   HPLDFYRFGTILFVVEDIGFFRALSYIEMLVEASCRREVMVRKLEVLWKRQVGKDGPQN
FT                   NISYEYAERICYFYGSIKIEEEVERYLNNHQCGAVAVAVCAGPSIREAVTKTIRLRTGR
FT                   NLQLMVFDPDMCPAPDGLVDSLSSDETPAGSQDPPHQLLGVGEDRHTHQVRRFLADSSK
FT                   LQYPSPKEIYTEAGNVEMNNHSKWVESRLAQGRRKPTTTKP"
FT   CDS_pept        join(complement(103532..104103),complement(103238..103373),
FT                   complement(103100..103160),complement(102944..103065),
FT                   complement(102673..102769),complement(102107..102396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948696"
FT                   /orf_name="Pc13g00410"
FT                   /product="Putative uncharacterized protein Pc13g00410 "
FT                   /protein_id="CAP91110.1"
FT                   /db_xref="UniParc:UPI0001830E8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H169"
FT                   /transl_table=1
FT                   /translation="MSQCQKGISLLFRHEGYYEIACSIMEQLTASDVGALLASLRITPA
FT                   QHTVETFLQPLRDFDPTMRQFESWFQDKCQILIIGPDTIRLSDRIFNADEYYKGKRPSQ
FT                   TQLEVWIFAIPANFEKGAKEVQCLRHCSHASSLFSIQERAEALIAGQELLENNLIRQIS
FT                   YTDAEPSKVPGEYLDVKVFDLFSTTTHRRERPSASSKTPKPGILPRVPGLGSTVNGFYP
FT                   YQLVLNSCGALSQQRKYLGLDDADPTAVDVEPETSHQVASWRPLQFHAPPSHRSQSYRS
FT                   LMVQALIHAFRTNYSAHSSSNNSICFILSLTGPRSKCRDPGSQCLDIQNKRHPTQRFEF
FT                   IIMSLQAEVSRMQHEYILMLQNGDNMLRAYANENAKLEEQNRSLLEHVKLLQQENCSLE
FT                   LDHNRLESELAKERLQCPEQADGKRL"
FT   CDS_pept        join(104179..104213,104329..104391,104641..104771,
FT                   104827..105072,105124..105165,105326..105564,1
FT                   05615..105734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948697"
FT                   /orf_name="Pc13g00420"
FT                   /product="Putative uncharacterized protein Pc13g00420 "
FT                   /protein_id="CAP91111.1"
FT                   /db_xref="UniParc:UPI0001830E90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H170"
FT                   /transl_table=1
FT                   /translation="MKLLPKMSRDNNSLLGESLSLPEYLACWCEDLTCSVPGSGKLVPG
FT                   IQVCVPGGFWAPRNTRPVPRDIHSAPRRRLGVHDITSNPVARNPAYKFNPVPVHLHVAR
FT                   TAAIMQVSPKVHTALATVLLIVSLVRLELSRRAARGISHLALDLAVSVPKDVLLGNTWD
FT                   IQRLSVLTRATLVGIYVYLPLQHAVLFLHFVDYLSLAYLLWSLDEYTTAGSRTGLQLRC
FT                   ALHWTMGLAAVLLLIAVFGVVLYCWLLSLELQLCILTIWMILSYYSVRSAGSSVDEQST
FT                   CSATVVVREV"
FT   CDS_pept        join(complement(106302..106418),complement(105856..106257))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948698"
FT                   /orf_name="Pc13g00430"
FT                   /product="Putative uncharacterized protein Pc13g00430 "
FT                   /protein_id="CAP91112.1"
FT                   /db_xref="UniParc:UPI0001830E91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H171"
FT                   /transl_table=1
FT                   /translation="MESPSKTSEGTGTQAEAPLYTQSSPTEEPPLPDVATPLPTLNHDI
FT                   ERQTLAVEPFRPILEVLKQIEEEDTELAFRAAHLVGYIRCLWESCVSKHTDIQQLEEEN
FT                   EKLRTGNIQLCNEGNRLKRYQDEQVSRLHAIDDALDEVRGRLIGVLKVWNDRSVGDLAI
FT                   LPEDGFPRC"
FT   CDS_pept        join(complement(107391..107694),complement(107234..107304))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128940"
FT                   /orf_name="Pc13g00440"
FT                   /product="Putative uncharacterized protein Pc13g00440 "
FT                   /protein_id="CAP91113.1"
FT                   /db_xref="UniParc:UPI0001830E92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H172"
FT                   /transl_table=1
FT                   /translation="MPLISRQPTHPAGDELDTMPLLVRRPNTRPSRKSKGANSPAQSTL
FT                   QRDQPTLRLRLQQRCMTPEAWWTSLTAFGAHDNISKHMLEHEKAIATEEIRQEWMRLSA
FT                   GETMFQGNEPSITRELSCLS"
FT   CDS_pept        join(108837..108909,108956..109194,109254..109637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128941"
FT                   /orf_name="Pc13g00450"
FT                   /product="Pc13g00450 protein"
FT                   /protein_id="CAP91114.1"
FT                   /db_xref="UniParc:UPI0001830E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H173"
FT                   /transl_table=1
FT                   /translation="MVLTSNERRAFFRQQCREALAAHIYDRLGLVVAPSDVRLQPSVGD
FT                   KYAWSVTESKKSLLQTNLSSGSVGLYRSICEELGRSLEAVTPQTLQFARLERDHLPKEE
FT                   SGPARSDEEGNGSFTAKIRELECANHEIKNELGRTSIHLQESLGENRTLHAKIRQLQDE
FT                   LDSISSRETQLEDELVRISGGITKAMQVLQEYEAHERGMLYGGRQREYCDSTDSMALGI
FT                   PAPIRDEVF"
FT   CDS_pept        join(110609..110643,110855..110961,111059..111771)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948699"
FT                   /orf_name="Pc13g00460"
FT                   /product="Pc13g00460 protein"
FT                   /protein_id="CAP91115.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001830E94"
FT                   /db_xref="UniProtKB/TrEMBL:B6H174"
FT                   /transl_table=1
FT                   /translation="MHKYRRISILASYITFIPIYCRHLGTDKHHLSSTLSPFPLNSVAQ
FT                   NHASTLEGGDISALARTHSTFYPKLRLALIKYNIRHQNSSALHWAAKNNNRAFAKTLLS
FT                   YQADVNALHDGFSPLMTAAKYGSELITNLLLRKKNLHVNRRNADGESALWYSVAKESSA
FT                   VVNQLLQHPRTKIDLPNREGQTVLWLAVFRGNRDLVSLLLSRGANPNTMDRYGMSPWIQ
FT                   SCVRRGESIKYLLLDHMKAVSPEIFSVDGVFAENGKSICEDSSSYGQSQVQLRAKRVRY
FT                   AHV"
FT   CDS_pept        join(complement(112570..113088),complement(112413..112512),
FT                   complement(112155..112342),complement(112000..112104))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977822"
FT                   /orf_name="Pc13g00470"
FT                   /product="Pc13g00470 protein"
FT                   /protein_id="CAP91116.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830E95"
FT                   /db_xref="UniProtKB/TrEMBL:B6H185"
FT                   /transl_table=1
FT                   /translation="MDPIKRQPSRPEPEWRDGTPDWAALERTSRPSVPSSRPQPGPVII
FT                   PPTLSLPHPALQKGQIEQTIQPVFENPWLTYEAIVVISQGQSVFLARHRKDKATLVDIH
FT                   LLKQQFSSVKPLLDTISQTSHPSFLGLVGCYCWEEQVFLVREPVELSVSHILASRCTIT
FT                   EDEIAAIVRPVLGGIQYLRCHGRALAALSADTILLTELGGVRIAGVEHSCQINAAEMDA
FT                   ATMKLFALAEMVERLLMKNPSQYPWSAEIKNLPEELKRCDSPEKLLRSKLFEQLGDEGE
FT                   LKMLVNAANKTAYHNLESYKRI"
FT   CDS_pept        join(complement(113839..114623),complement(113532..113784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977823"
FT                   /orf_name="Pc13g00480"
FT                   /product="Putative uncharacterized protein Pc13g00480 "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91117.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001830E96"
FT                   /db_xref="UniProtKB/TrEMBL:B6H186"
FT                   /transl_table=1
FT                   /translation="MSDPQWLWDPLSICEMGPIRETKTCCGITKKGDACKLIVKKDTLK
FT                   EGRHKLNNLARGPFNLSTLDSQLSDLVSFFLCKQWHRERQHNDVKQRWFDAAVRNQADV
FT                   QESPRQRFPHIIAEEIDGPQQEPASTALETDGFAPIWGVDAAFPRLPSPTWLEVTRPPG
FT                   RDVTPGMLTMNRVPWNVSRDNPAILSIHNEYGGLHSLQIHTVRQESCPDGERCPICFEG
FT                   DSDDLVMLQCGICKGVVHLGCMEGWLAHRLPGNNTSCPIHRCNGSFRALLRSSAVGNAT
FT                   GNSTAETPLEDTYTPVEETSVPTAPPQRRSTQTTRRSDRPRVFSSSSIIRRSPRSRRVP
FT                   DRFLP"
FT   CDS_pept        join(114755..114975,115059..115185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948700"
FT                   /orf_name="Pc13g00490"
FT                   /product="Putative uncharacterized protein Pc13g00490 "
FT                   /protein_id="CAP91118.1"
FT                   /db_xref="UniParc:UPI0001830E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H187"
FT                   /transl_table=1
FT                   /translation="MGGDNLDALCFAGQTVELPEALGLLEPEYVFLETGRVLPGNDTGI
FT                   PGSPCSPRSPYLSPKEPDFRSQEPSSLQPGPRVPRNLYCFPRRREKRHVQHRSFDCRVI
FT                   NQGPLGLFSFI"
FT   CDS_pept        join(115315..115574,115660..115756)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671896"
FT                   /orf_name="Pc13g00500"
FT                   /product="Putative uncharacterized protein Pc13g00500 "
FT                   /protein_id="CAP91119.1"
FT                   /db_xref="UniParc:UPI0001830E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H188"
FT                   /transl_table=1
FT                   /translation="MSIVPTAHPSVLSTNMHWSSDNLESLLGQIIGDPTHHLKCRWAED
FT                   NGVRCQNLVSKDSRIDGAICLKMFQDLPTGHSPAMGLSKAARPVKQRKLLKLSKMGTIS
FT                   LFYRHTAGRLACPT"
FT   CDS_pept        join(complement(117225..117313),complement(117129..117162),
FT                   complement(116626..116985))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977824"
FT                   /orf_name="Pc13g00510"
FT                   /product="Putative uncharacterized protein Pc13g00510 "
FT                   /protein_id="CAP91120.1"
FT                   /db_xref="UniParc:UPI0001830E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H189"
FT                   /transl_table=1
FT                   /translation="MQTSGSRTVSNLDRLTVYGPKELKRTVHDPAIYTSPTSVAREYLR
FT                   LLARLDSRAVRAERAQSKLEQELSASRAAENQATEELGHVSRLADIFFELSQILGGVVD
FT                   HWLKERGTKEPGQEPESTKVMLDVLLKQLEAQEFANSGEKSGDDSESGTEAAAQRS"
FT   CDS_pept        join(118628..118783,118963..119412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671897"
FT                   /orf_name="Pc13g01200"
FT                   /product="Putative uncharacterized protein Pc13g00520 "
FT                   /protein_id="CAP91121.1"
FT                   /db_xref="UniParc:UPI0001830502"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /transl_table=1
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
FT   CDS_pept        join(124917..126780,126842..127294,127657..127882,
FT                   127928..128045)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948701"
FT                   /orf_name="Pc13g00530"
FT                   /product="Pc13g00530 protein"
FT                   /protein_id="CAP91122.1"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI0001830E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H191"
FT                   /transl_table=1
FT                   /translation="MPGGHPTTTAIQNDLAEILLGLFIPWQNLQSLFHQTRTGSATTVD
FT                   LHHIWMSIEPTLSSYVRTFAQNIELLRKSKTDCQADAILRDRSAQNTSSVDQDLTSPPY
FT                   PISDSENESIRFSQHVDDSISKETLLAAFFAIGRGWSNEANDAQRRIPTLTSTSLPSSP
FT                   LQFDNFGPIPISNSTLYESTGLQFFPLFTLQEWKTRLQNITKAVNQDTQPGMPTTTASD
FT                   LDDFNLGMADDVLVPILTEPDLSLDLQHRRSEIGQNPTGASLTSLVRDIIPLNEKQRLV
FT                   VERVISNLLACVNHPYDSSMRQQTLLYVGGEGGVGKSQIIKAIVAVMDLIHRKDEVILM
FT                   APTGAAADVIGGSTYHTSLGISLNRYRRGGVAPRVRSLWSRKTVMIIDEVSMIDLSALS
FT                   IINTHCKIARSLDRSSPHLFGGLPVVILMGDFHQFPPVQGQALWKLPRNDTEQDGKLIW
FT                   NQFQQVIILHEQMRQAEDIPYQNLLGRARSGTLTSDDLSTLNSKAITSLTDPHLQPATV
FT                   IVKLNSLRHVINRLQIERFARARHQNIFVFPALHTRTRSSGPTSLQLRADDLLGLPEQG
FT                   AKVPFPGLILYTLSMPTMVLTNICTPAGLVNGATGQAMGIAIDPQAEFLKLDDLYIFCT
FT                   KPPVCLLFKPARTQSNLFQSLDSGILPIFPLEMSITVKGYSVRRKQIPICPAFCLTDYK
FT                   IQGATLDSVILDLKDDTKSRRQESHRKYCSTYVQLSRLRSLHGLHLLQSISMSDLEHRP
FT                   DPQLLEEMRRLQTLQEQTLGLSLQLRVSLNIPSQDIHSDDVEQNEIPTLIRFFNEGNRP
FT                   DLYQPNAFVYSSGSFPTTSSEDEGFHIVLHAHNLDRHPGNQEDTASYFMHCPGAAQPIV
FT                   TFLGVAASFLSGVVT"
FT   CDS_pept        join(complement(128600..128878),complement(128133..128534))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977825"
FT                   /orf_name="Pc13g00540"
FT                   /product="Pc13g00540 protein"
FT                   /protein_id="CAP91123.1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="UniParc:UPI0001830E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H192"
FT                   /transl_table=1
FT                   /translation="MDMAELDLQLTNKRLRVLVLYGSLRRRSYSRLVALEACRILFRLG
FT                   CDVRIFDPEGLPVKNDSDTDHPKVQELRELSVWSDGHVWVSPEQHGNLTAVFKNQIDWI
FT                   PLTTGSVRPTQGRTLAIAQVCGGSQSFNAVNSLRILGRWMRMFTIPNQSSIPRAYTQFP
FT                   DEGQPEDQRLMPSGNRDRLVDCMEEFIKYTILMRPHIGLFGDRFSEREEKKAKEEKMNA
FT                   AAAR"
FT   CDS_pept        join(129330..129452,129547..130191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824592"
FT                   /orf_name="Pc13g00550"
FT                   /product="Pc13g00550 protein"
FT                   /protein_id="CAP91124.1"
FT                   /db_xref="UniParc:UPI0001830E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H193"
FT                   /transl_table=1
FT                   /translation="MTKYRHWVPFQLGRMFRLLYEFNYTPQIRAFITLIPIPRTREYIQ
FT                   QLEQQLRSFQRLGVAATQDVQKAGRKVAAENASLRSLLMIHGVTKIQIEEYLESQRQTA
FT                   SSIQSQYPSVVSLPSTNLHRPTADGQPSVDHHHSLSSQEVNSTSHPPKTLEVRSSPPRS
FT                   DPKISMNISNRQESSAGRAVELGSVTAETVPDSQHFGGVQDTGQFTSCVTAASLIESIR
FT                   NHSDFRDVRSELGCDSEPNCMVKNMSIFDILDR"
FT   CDS_pept        complement(130867..131547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824593"
FT                   /orf_name="Pc13g00560"
FT                   /product="Pc13g00560 protein"
FT                   /protein_id="CAP91125.1"
FT                   /db_xref="InterPro:IPR012389"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI0001830E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H137"
FT                   /transl_table=1
FT                   /translation="MSNNFQRKSQDDAHSPNGPLVYRLYSKLNISQLGQRWHPRSDVKL
FT                   LPAKYELTEPSDLVVLISSMLMQLIRINDKMPLQQGQQTRFHSRTAPQIPVFNYLQRLA
FT                   THAKLPSAILLSMVYYIDRLCMLYPAFTVSSLTIHRFLIVSAAVASKGLSDSFWTNKTY
FT                   AQIGGISTMELAMLELDFLFRMEWQIVPQPEVLTDYYRHLVDRCESFKINEPNSNISTV
FT                   SVLR"
FT   CDS_pept        join(complement(133640..133922),complement(133446..133588),
FT                   complement(133311..133397),complement(132590..133246))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128942"
FT                   /orf_name="Pc13g00570"
FT                   /product="Pc13g00570 protein"
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91126.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniParc:UPI0001830E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H138"
FT                   /transl_table=1
FT                   /translation="MAAPTGRHPTKESEYHNSILHSQPPTPTAEDVEKQESEESTAKQS
FT                   AFKGLGWLDRFLALWIFLAMAVGIILGNFVENTGPALQKGKFVGVSIPIAIGLLVMMYP
FT                   ILCKVRYESLHHVFRERGVWIQIGFSIFINWIIAPLLMLALAWAFLPDEPELREGLILV
FT                   GLARCIAMVLIWTGLAGGDNEYCAILVAVNSLLQMVLFAPLAILFIKVIGHSGSQVTLS
FT                   YSTAAKSVAVFLGIPLGAAIITRIVLRKITSPRWYDQVFLKWAGPWSLIGLLFTILVLF
FT                   ASQGRQVVHQIVSVVRVAAPLIVYFIVVFFITLLVTYKLGFGYKLSATQSFTAASNNFE
FT                   LAIAVAVATFGANSNQALAATVGPLIEVPVLLGLVYVAKFIAKRAGWKD"
FT   CDS_pept        join(134893..135215,135356..135408,135572..135603)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824594"
FT                   /orf_name="Pc13g00580"
FT                   /product="Pc13g00580 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAP91127.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI0001830E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H139"
FT                   /transl_table=1
FT                   /translation="MAKPSVLFVCVHNAGRSQMAAGYLMHLAGDTIEVRSAGSAPADSI
FT                   NPVVVEAMREEGIDLSNQKPKILTADAVQDSDVVITMGCGDVCPFFAGKRYLDWQLNDP
FT                   AGQGVLGEQPLCGGWPLVALLTSVCPYKDAG"
FT   sig_peptide     134893..134943
FT                   /db_xref="UniProtKB/TrEMBL:B6H139 "
FT   mat_peptide     join(134944..135215,135356..135408,135572..135600)
FT                   /db_xref="UniProtKB/TrEMBL:B6H139 "
FT   CDS_pept        join(136113..136426,136472..137147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824595"
FT                   /orf_name="Pc13g00590"
FT                   /product="Putative uncharacterized protein Pc13g00590 "
FT                   /protein_id="CAP91128.1"
FT                   /db_xref="UniParc:UPI0001830EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H140"
FT                   /transl_table=1
FT                   /translation="MPSNSTFPAIIHIRDFVEHVEPDPTRPGKGLSLQLRVSLNLPWKD
FT                   IQSDDVEQDEILTLVRFFNEGNQSDLYKPNTFVYSSGSFLTTSSDDEEFHIVLHAHNLD
FT                   RHPGNEEDIESYFMHCPEAAQPIVTFLGVVIERGGQLNGGPTLLHYRLQTTVYNSSTRT
FT                   NHTFPITAYFKNGQRWANFPPLSMNTHVFLTGRVFGLTKEHRQLAVVTDDIHFLPTPNN
FT                   QLPATPPSTGKRKRVDRWSQRAGPQTPTKSAARPQTESLHITYQSQDPTQMIAPGEDDE
FT                   EDAQITWPDTPEEIKASSRTTTPVPERRSQRPRKTSYADILAQSKYDT"
FT   CDS_pept        join(complement(142177..142532),complement(141890..142115),
FT                   complement(141771..141830),complement(141426..141716),
FT                   complement(141141..141369),complement(140929..141088),
FT                   complement(138607..140872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824596"
FT                   /orf_name="Pc13g00600"
FT                   /product="Pc13g00600 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91129.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F60"
FT                   /db_xref="UniProtKB/TrEMBL:B6H141"
FT                   /transl_table=1
FT                   /translation="MASQKKWYVFRVTGLSRERPDGDLETTLQEAIDDNFADDETSHIK
FT                   PEIKIVPSCYESDTERAALVQFRGGVPQFLAELRVNPLGDWQIEMGDDDISFDCHFFGF
FT                   TQLYMPDGNKPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELIEEIKKIRNTKELQQRPLIFIAHSFGGIIVAHCLVKAIQT
FT                   MEGDHPAITSLYQATYGMILFAIPHKGLMMDDIQQMLAGDQSHPRERLLQQISSKSDLL
FT                   IHQLADFKNLIRDRKVVSFYETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDH
FT                   VEDKVPLHADHSMVVKFNTRNAAGYRTAVDKLRQFLKDAPSMVAARFTQTRPKPQPCST
FT                   VPFKKDPMFVGREVVISAINERYRAIGQRHERVGLVGLAGVGKTQTAIEYSYRVRESTP
FT                   DTWVFWIHASNTARLEQGYQQIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLVVLD
FT                   NADDDGIFFSDNTFNERGPLVSFLPQAAHGSMLITSRNGLAARNLVGSESHVIRVQPMN
FT                   EAESLSLLRARIPAPQSGESGESGGNERALVQALECIPLAITQAAAYIANRLPLVTVTE
FT                   YLRLFHESESKRTRLLQNEDSADLRRDPSIRYAVITTWQLSFEQIRQERPTATDLLALM
FT                   SMFDRQGIPEDLVRDHNQDILDFHDALAPLLSYSLIRLEINERLFDMHRLVQLSVRAWL
FT                   DMHQQLYGWQAKSRQIMARVFPGGEYESWSQCRSLLAHANSVLQSICDVDDEDRLNAAT
FT                   LLSNCGWFLHLQGVYEEAELMHRRALEARENALGREHPDTLTSVSDLGLVLSSQGKYDE
FT                   AEAMHRRALEARENALGREHPDTLTSVSNLGDVLSSQGVYEEAEAMHRRALEARENVLG
FT                   REHPDTLTSVSDLGNVLSSQGVYEEAEAMHRRALEARENALGREHPDTLTSVSNLGDVL
FT                   SSQGVYEEAEAMHRRALEARENVLGREHPDTLTSVSDLGNVLSSQGKYDEAEAMHRRAL
FT                   EARENVLGREHPSTLTSVNNLGLVLSSQGKYDEAEAIYLHDMEGSEKVLGCEHPNTVTS
FT                   INNLGLVLSSQGNYDEGEAMHRRALEAREKVLRREHPDTLTSVSTLGNVLSSQGKYDEA
FT                   EAIYLHDMEGSENVLGCEHPGILASLNIR"
FT   CDS_pept        join(complement(150675..151884),complement(147170..150642),
FT                   complement(146658..146795),complement(145447..146602),
FT                   complement(145190..145250),complement(144001..145063))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(156706..157073),complement(156419..156644),
FT                   complement(155952..156242),complement(155670..155898),
FT                   complement(155446..155605),complement(152801..155387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977826"
FT                   /orf_name="Pc13g00620"
FT                   /product="Pc13g00620 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91131.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F61"
FT                   /db_xref="UniProtKB/TrEMBL:B6H150"
FT                   /transl_table=1
FT                   /translation="MANQRKSHVFRVTGLSIKLPDGDLKTDEDFRTALYGTLNDNFIDD
FT                   ENSQIKSDITIVPSCYESDTQRVALVQFRGGMPQFLRDHDPLGDWQVEIGDDDISFDCH
FT                   FFGFTQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTM
FT                   IYGYNSKLSSPGVNTILDYGRELMEEIKKIRNTKECLVRAIQTLEEDHPAITSLHRATY
FT                   GMILFAIPHKGLVMDDIQQMLGGDGHHPREKLLRQISSQSDVLIHQLADFKNLIRDRKV
FT                   VSFYETEQTKRLVLDLESGCWKRTGDFMTTVDADSALLQLPDHIEDKVPLHADHSMIVK
FT                   FDTRNAAGYRTALDKLRQLSKDAPAVVAARFAQTRQKPQPCSTVPFERDPVFVGRKYEI
FT                   NAIEKKHGTIGQRHERVALVGLAGVGKTQTAIEYSYCVRESTPDMWVFWIHASNLERLE
FT                   QGYRQIAAVTEIPGRDDPKINILQLVYQWLCDARNGRWLIVLDNADDDSIFFRENESKE
FT                   RGPLVNFLPQAAHGSMLITSRNGRAARNLVGRNSHVIEVQPMNEEESVALLRRWIPAPQ
FT                   SGDFGESGEDEKALVQALEYIPLAITQAGSYIANRLPLITVTAYLRLFHESESKRTRLL
FT                   KNEDSTDLRRDPSIRYAVITTWQISFEQIRQERPVASDLLALMSMFDRQGIPVDLVRES
FT                   EQDELDFHDALVPLLNYSLIRLEINERLFDMHRLVQLSVRAWLEMHQQLYSWQAKSREI
FT                   MARVFPDGEYESWTQCRSLLAHAKSVLNSIYDVEGEDRLNTATLLSNCGWFLNLQGAYE
FT                   EAELMHRRALEAREKVLGREHPSTLISVNNLGLVLSKQGQYDEAEAMHRRALEAREKVL
FT                   GREHPDTLTSVNNLGLVLSNQGKYEEAGAMHQRALEAREKVLGREHPSTLGSVSNLGNV
FT                   LGRQGKYEEAEAMYRRALKAREKVLGREHPDTLIGVSNLGVVLFKQGQYEEAEAIYRRA
FT                   LKAREKVLGREHPDTLTSVNNLGDVLSKQGKYEEAEAMHRGALEVKEKVLGREHPSTLI
FT                   SVNNLGLVLTKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGLVLKSQGKYKE
FT                   AEAMYRRALEARQKVLGQEHPDTLGSVNNFASVLSKQGQYKEAEAMYRRALDGYEKVLG
FT                   REHPDTLMSVNNLGSVLFKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGDVL
FT                   SKQGRHEEAEAMHRWAQTVDSSTLMQQGILLKNIFSTPHPLLQLSLRHHRSLEEKHDRD
FT                   VD"
FT   CDS_pept        complement(158328..159968)
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<160324..>161142)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948702"
FT                   /orf_name="Pc13g00640"
FT                   /product="Pc13g00640 protein"
FT                   /protein_id="CAP91133.1"
FT                   /db_xref="UniParc:UPI0001830F62"
FT                   /db_xref="UniProtKB/TrEMBL:B6H151"
FT                   /transl_table=1
FT                   /translation="DLDTSLDYLPGHPRIKLGDEKGLFDFIRREVWSEDLESISGRLWW
FT                   MSKQDGSNISPLHRQRVKGRQIIVTEDPRLHLVWIDDRIFLKTLPQYIMSYVFWDTFLS
FT                   DPSKYGAEVKLRMAALGYLRTYFYLIQHESDLRIAKDPALSLVPKEVTWPQFCQFTACF
FT                   HNITDHEVSERYHYGEIRLTRLNYYAPVLLGKGHYQRVNHQYRAYFARIQGPVISAFAF
FT                   FSILLNCMQVSLAASASDERYSSAPLFASCYWFSTVIGLLTGVLLLMLVLL"
FT   CDS_pept        complement(161665..>163221)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948703"
FT                   /orf_name="Pc13g00650"
FT                   /product="Pc13g00650 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91134.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="UniParc:UPI0001830F63"
FT                   /db_xref="UniProtKB/TrEMBL:B6H152"
FT                   /transl_table=1
FT                   /translation="HTYAIQSISTGIPASTLWRRANNRPSIADKAANQQYLTPQEEQAL
FT                   VEYVLRLADNGYPLSVKFLRSLALIIVRQRSSNFQITDPSLKVRTPGKNWPQGFYRRHP
FT                   QLKARRLRAIDWKRDGRHIEDKVRHWFDIIGRELANPAILLEVYNMDETGVLLSVLNSL
FT                   KVLVSKDDLRKHRGTTMKRTLVMAIECISADGRFLHPLIIWPAATHRSSWTTHPTPGWH
FT                   FSCSKTGYTNTEISLYWVEHVFDPQTRDRAGGRPRLLICDGFGTHESLEVMKFCFANRI
FT                   ILCRLPSHTSHKLQPCDVGVFSPLKTAYRAQIEQACRAGVSTIGKPHFTYLYDSARKEA
FT                   FTPRNIRSAWSRSGLFPFDPSRVLRECQASSEIQTTTPVEAPTVSSNICHTPNTSDSFA
FT                   LLRSEVEQDTQNLDGVCKRRLQTLSCATERVFAERALLLEENRILFEQNNEKTCRQSSG
FT                   LTVLGHAKVMSYEDIVEAQKKRDMTVTEQATREKRSKLGASCFRNRRRSARRSRRFKHG
FT                   I"
FT   CDS_pept        join(164634..164989,165051..165276,165453..165743,
FT                   165800..166028,166086..166495)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128943"
FT                   /orf_name="Pc13g00660"
FT                   /product="Pc13g00660 protein"
FT                   /protein_id="CAP91135.1"
FT                   /db_xref="UniParc:UPI0001830F64"
FT                   /db_xref="UniProtKB/TrEMBL:B6H143"
FT                   /transl_table=1
FT                   /translation="MASQRKSHVLRVTGLSRELTDGDLTTALQEAINDNFTDDEKSHSK
FT                   VDISIVPSCYEDNTQRVALVQFRGGVPQFLDELRVDPLGEWQVEIGDTDINFDCHFFGF
FT                   TQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPRCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMIL
FT                   FAIPHKGLVMDDIQQMLAGDKSHPREQLLRQISSKSDVLIHQVADFRNLIRDRKVVSLY
FT                   EMKQTRRLVLDSESGRWKRTGDFMTTVGADSALLQLPDHAEDKVPLHADHSIIVKFDKR
FT                   DAPGYRTALDRLRQFSKDAPSVVAARFNASNAPAALLQGSAVRKRNIIDNDSETPKAKR
FT                   ARLYDSASSPNSEESDTTHYEDDNIFDDISQEKVYNMGEPWEESHKSFSGSLTARDATS
FT                   EIGSPFRYGSSSREGSSSEYELADESDILEPDELSMSEESISSAC"
FT   CDS_pept        join(168263..168304,168493..168861)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948704"
FT                   /orf_name="Pc13g00670"
FT                   /product="Putative uncharacterized protein Pc13g00670 "
FT                   /protein_id="CAP91136.1"
FT                   /db_xref="UniParc:UPI0001830F65"
FT                   /db_xref="UniProtKB/TrEMBL:B6H144"
FT                   /transl_table=1
FT                   /translation="MFSSRQVAFSSLGAFLTAPKTKRSKPGRSPAPVGTERELLTSHGM
FT                   HSAQSMRHDLLDLPLIYSLRPSRLPALRAVSKRNGDYNIDCANGFGIQPLPSAETSARM
FT                   AMANFDANADPLANADRVIINGWDXSMAGTIL"
FT   sig_peptide     join(168263..168304,168493..168522)
FT                   /db_xref="UniProtKB/TrEMBL:B6H144 "
FT   mat_peptide     168523..168858
FT                   /db_xref="UniProtKB/TrEMBL:B6H144 "
FT   CDS_pept        join(complement(170170..170323),complement(169867..170134),
FT                   complement(169794..169811),complement(169552..169744))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948705"
FT                   /orf_name="Pc13g00680"
FT                   /product="Putative uncharacterized protein Pc13g00680 "
FT                   /protein_id="CAP91137.1"
FT                   /db_xref="UniParc:UPI0001830F66"
FT                   /db_xref="UniProtKB/TrEMBL:B6H145"
FT                   /transl_table=1
FT                   /translation="MFGYGHFSLRIFKGSNSPHFLLPSIPYFTVSPRTPCLTSRQLQWV
FT                   TKEIRSGSPEPNDIWSPRTSIAGSVDDDCHSQQTDVSDEEGKATSMDGCSDEEETQGQW
FT                   AKEHTKERALDGARSVKFLKPEDSTESMVKMIECMAELDGRVQSDAKSLEGQDRWNQGM
FT                   QRKYIDMIGAIDTLSKDVATLRKQVEALSSRDAAKTREVVGSKRQKQ"
FT   CDS_pept        join(171241..171568,171623..171747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948706"
FT                   /orf_name="Pc13g00690"
FT                   /product="Putative uncharacterized protein Pc13g00690 "
FT                   /protein_id="CAP91138.1"
FT                   /db_xref="UniParc:UPI0001830F67"
FT                   /db_xref="UniProtKB/TrEMBL:B6H146"
FT                   /transl_table=1
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKQNYLLREYRSIQKSLPETT
FT                   SSGAVPLRVQREEARMSCLPSLPIYAPRGSRTKTRLLIHALEQLAVSERRHLTNDSDSA
FT                   NERLPGYTIRPPHTLRSAPSRHISYLWKFVHPMAAATRASRNAEIL"
FT   CDS_pept        join(complement(172843..173005),complement(172662..172770),
FT                   complement(172326..172551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948707"
FT                   /orf_name="Pc13g00700"
FT                   /product="Putative uncharacterized protein Pc13g00700 "
FT                   /protein_id="CAP91139.1"
FT                   /db_xref="UniParc:UPI0001830F68"
FT                   /db_xref="UniProtKB/TrEMBL:B6H147"
FT                   /transl_table=1
FT                   /translation="MSYAQILRSSRQPGGYEAQIASLMPPEEEQQQTRITPFHLKGNPD
FT                   LASRAKDEKAIFAVNPAKPRVSSYRTLQWLAFCADFEIDSLHKRVKKIEHFINGITQNG
FT                   FADVLTENATLLSETTALKDKIQELEETLENMQARVDELCKERQVSTVQNNPARKKRAM
FT                   PQ"
FT   CDS_pept        join(complement(174520..174541),complement(173650..174437))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948708"
FT                   /orf_name="Pc13g00710"
FT                   /product="Pc13g00710 protein"
FT                   /protein_id="CAP91140.1"
FT                   /db_xref="UniParc:UPI0001830F69"
FT                   /db_xref="UniProtKB/TrEMBL:B6H148"
FT                   /transl_table=1
FT                   /translation="MSKTRLVASSISTYDDRVLVPGTTERCCTPPEGAQNLPHGAQGSE
FT                   GAQNLPHGAQGNEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPH
FT                   GAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPHGAQGNEGAQNLPHGAQGSEG
FT                   AQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHG
FT                   AHGSEGAQNLPHGAHGSEGGQEACSYSPKWARRAFLSVPTTRLDKYH"
FT   CDS_pept        join(176999..177032,177089..177328,177465..179262,
FT                   179303..179318,179494..180063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824597"
FT                   /orf_name="Pc13g00720"
FT                   /product="Putative uncharacterized protein Pc13g00720 "
FT                   /protein_id="CAP91141.1"
FT                   /db_xref="UniParc:UPI0001830F6A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H149"
FT                   /transl_table=1
FT                   /translation="MASRVNQLASDVIKANNTVLEEILRRDRILRRNPQPSRRSAGSPF
FT                   PLESAEEPANFMQVQIDVDPPDGMAIETQRTDAQASASKRGAGTRNYKVRKNQSQEEIA
FT                   QNFHGTFTQKRTFHAIEAKVYFLTGKSHFRKRNKKTSRKRPVSLTPRSSPPPSQFSGSV
FT                   DSTQQLISRSSIEVHDLRLAPNLLPYLNSEDCEDGDSYGLHGVQPVDPERETSDLHAVP
FT                   EQDTANQMLSCQRAPQEREPQSGTSQNESPVRGSRQAEESPKAHPGFSDLVGESQPRNG
FT                   NPTNVFAAISKMGDACLPRSSPLEPPRISEPIQSPIRHPPEDDITLEWLGQTLSCCAET
FT                   STMHMEQADTAHGNQSLETLSPQSSSRENSLTRGSENEGFNDESHTESVPRSPTPFQVP
FT                   EPSSTGNSTEHHPQNCGMDEPTIDASESAFIDKKLIIRCLHEKSKSQAARSHPNWNHKD
FT                   LNRLLGWHMKRKNLPKERLEVEFLRDFGHYRSSSAIVTACRRKRKADSRHKDVTSAPTP
FT                   GRLTPLAPVLNTKPVSRPPNAIIGSDTPSLHSSHTAAVPSNENTTLKPPPLERSRSRHL
FT                   TQPQILGNIDRFSRDMAPPLHESDETVDQSSPAAVAPESASGQMVCWTPDSAEDTPTLG
FT                   NRRHRVEITPKPPSRFTAINGGNVHPADPNSTAQPETNKRDAVPNGQGGQRASKEKKKG
FT                   SRLTPEHELAGSNNSKRSAGTSEGAENQRSLPIDVSDANIAQLGMRTDLQNTSQSQERD
FT                   VDIPPKNNSQLTYIQNPDPNCPPNSQVANTRPSHFCRPNSQSGASQTSGVSGSAHTGGL
FT                   FTPHTSGPAYPDMRPEAIVPISVSASFLSSPTCLPHYPLHVLQGGGAERYQGPPLPSLA
FT                   QQMYYHRTGEPLHK"
FT   CDS_pept        join(complement(182961..182994),complement(182691..182888),
FT                   complement(181507..182633),complement(181317..181367))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128944"
FT                   /orf_name="Pc13g00730"
FT                   /product="Pc13g00730 protein"
FT                   /protein_id="CAP91142.1"
FT                   /db_xref="UniParc:UPI0001830F6B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H153"
FT                   /transl_table=1
FT                   /translation="MGSRSLSSEFQECERKCQWLEQSRAPSTVHLPSDRWWGLITLHLN
FT                   LLHEHEQFFVMCQHPSVSLDVKNVPEKYEMSDRSLKYMLCFIETVSSILKRLILSNSEL
FT                   GDSLFEQLGDVARYGMFAEKLNREYWNVISRCWYQKAADRNPDSGRIQHHLGDLSQPDP
FT                   LQTLFFLTKALISAQPFPGSRVTVGRFFNDWPNLALQENSMATYFIAAHYVLLRGDSTG
FT                   RFMTFINGFLSLLPSYMEHHGHQGQHTVYVMSCNFASVFGYHNPAFMAVGSSQSQSGHT
FT                   PQTNELGPANQKQACVSNCSINQPAYPTKQALQGVHLTFRTLSVLLQYSNGHNSVPAIH
FT                   ISLAFLWGLTCHHPFMESLEARVPWRAITRFLNSLITPNDDFPKIEDASFPAADDGAAL
FT                   QLPEDFLIRGQTWSQLYYPKGFFNGSGDSISIEVDSEVKIRRYRCLWLGVQLAMTVIAT
FT                   TKHPEAEIKAN"
FT   CDS_pept        join(complement(184521..184918),complement(184001..184451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948709"
FT                   /orf_name="Pc13g00740"
FT                   /product="Putative uncharacterized protein Pc13g00740 "
FT                   /protein_id="CAP91143.1"
FT                   /db_xref="UniParc:UPI0001830F6C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H155"
FT                   /transl_table=1
FT                   /translation="MSTRDLFSFEHMSYTSSPQYPSGSPVGMVDSFETGSENNVVDGGP
FT                   PPAPVALSTYSTPPLPPKYRTIKPRFSDGGLMPKPPDDTLGVKPRRHRSSGTRRNRQRQ
FT                   PQEKIGEPNPVQPEADSSMVSFTRPRSESFVPVTQYTDSDLFSRSQGPSLAPFLFSYSN
FT                   DLTSPAEIRSPLFPNIASAALAVDRPAYHHDVPSSLDSSDIQVSRPNPFFELSQDRDSM
FT                   RAASLQFSEHLEKTQVLQSLSILQDYMAKYPSVFEKQAPEMVQKWMLDIEGVKPPGSLS
FT                   E"
FT   CDS_pept        join(185578..185720,185803..185849,185902..186137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948710"
FT                   /orf_name="Pc13g00750"
FT                   /product="Putative uncharacterized protein Pc13g00750 "
FT                   /protein_id="CAP91144.1"
FT                   /db_xref="UniParc:UPI0001830F6D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H156"
FT                   /transl_table=1
FT                   /translation="MTINGMIPSYLELFPKDSCCTFLLINIQGPFQVNPMPISTSRGIL
FT                   RASTKPHLLSGSDELRHLDIIGCREKRKAVDRKPQTTYTFKNCTFSGTSMFLVGSAGPT
FT                   SETVVYRDYGSRRPFLVNGDKGEATFLRDFCGRREYG"
FT   CDS_pept        join(complement(187390..187503),complement(187069..187259),
FT                   complement(186585..187008))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948711"
FT                   /orf_name="Pc13g00760"
FT                   /product="Putative uncharacterized protein Pc13g00760 "
FT                   /protein_id="CAP91145.1"
FT                   /db_xref="UniParc:UPI0001831035"
FT                   /db_xref="UniProtKB/TrEMBL:B6H157"
FT                   /transl_table=1
FT                   /translation="MXTGFPAWXHNLPTPLPLDQVPRHIRLVGVSLNIPSGQPASPQAE
FT                   AHVGFHSHGKAIISXNIDEYALINHTIGFHGQEAFRXMQKSYKRVAMPSQAVHQSLKTQ
FT                   KHNGPNSCVPLQFSSLPANDNTARGLLSTKSPLPSTHCKRIFPVESDFSLIDQFVARNN
FT                   PALENILSNLKRCDAALLESFYRSAFEGLDPDTCEAILHLWMRALSPKALVGIQNTYSR
FT                   ELTYPGLCFQEPITLTRTDH"
FT   CDS_pept        join(188099..188101,188165..188704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948712"
FT                   /orf_name="Pc13g00770"
FT                   /product="Pc13g00770 protein"
FT                   /protein_id="CAP91146.1"
FT                   /db_xref="UniParc:UPI0001831036"
FT                   /db_xref="UniProtKB/TrEMBL:B6H158"
FT                   /transl_table=1
FT                   /translation="MISEADLKISAQTSLKALQIWSLGTPDLANAXKWQHDLDPEIASL
FT                   VVACQHLRKNGYRKGRRRLAQNSILNRLVQAMVEDLTDDSLKIFALLTWHFNADFSVPL
FT                   PRQLLLFFDEPSKIFEDVCTDIHRRYTTMAKPGSVKSFKRRFIRLLGLVEHYVFEGKWS
FT                   CIFKSSDYVIIVAAICQ"
FT   CDS_pept        join(190282..190458,190506..191009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977827"
FT                   /orf_name="Pc13g00780"
FT                   /product="Putative uncharacterized protein Pc13g00780 "
FT                   /protein_id="CAP91147.1"
FT                   /db_xref="UniParc:UPI0001831037"
FT                   /db_xref="UniProtKB/TrEMBL:B6H159"
FT                   /transl_table=1
FT                   /translation="MSHPGNNLSLFVRNLDQGTREHLGHNTNTGPAHLTPEPCSSIPTE
FT                   SQAPAIMSLVEDFYFPFPRTSFRAAETTLIVQQAWFLGSKYLKRAIKRQHKLNDRTTFL
FT                   ISSCQALRKYRYLPWGKRRALAKNRRLRNYAHRMAGELADCDLAMLSLLAWHFSSKMVP
FT                   LPQGLLQFFANFDEQFDTVCRSIHLSYTKMCEPDTLANFKERLRGLLRLXERHVIIGDG
FT                   VLYT"
FT   CDS_pept        join(complement(192437..192469),complement(192100..192387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948713"
FT                   /orf_name="Pc13g00790"
FT                   /product="Putative uncharacterized protein Pc13g00790 "
FT                   /protein_id="CAP91148.1"
FT                   /db_xref="UniParc:UPI0001831038"
FT                   /db_xref="UniProtKB/TrEMBL:B6H160"
FT                   /transl_table=1
FT                   /translation="MISAEELDELAKQQSSSNFNVGNLRIRILGQLVDSRSTNVYHMQR
FT                   EIRKTEEIPGTKDIMQELWFEHYWASQTELIKSSIGRDLLQDDASKGVSEPLPEDHAFD
FT                   YS"
FT   CDS_pept        join(complement(195666..195726),complement(195482..195616),
FT                   complement(194220..195308),complement(193886..194151))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948714"
FT                   /orf_name="Pc13g00800"
FT                   /product="Pc13g00800 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP91149.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001831039"
FT                   /db_xref="UniProtKB/TrEMBL:B6H161"
FT                   /transl_table=1
FT                   /translation="MWARLPTLVPLGICSGCRPLDAAVSTSESEESSRTCWSDDGAQPE
FT                   AARAGTRRPLVTGDPAGDDEVWSQHRQQFQDINQAIRREPRFILRVHRVHRVHRVHRVH
FT                   RVHRVHRVHRVHSVHSVHRVHRVHRVHRVHRVHRVHRVHRVHRVHRVHSVHKLIAANMN
FT                   KFAPIYQKHKDIGAEQTIPEADISLFEERLVIVCTVDETQNHRRVRIPNRVKLIRSRER
FT                   KAQRLYLKILEKFPGIFLAFILSVSPRASIDFDLSAFCEQHIEQPIVLCDNAESLLWRS
FT                   AIRHGIEKSKAFGKLMSLLFTLPRPATEAEGEEICSLSLSRLSVIRIAFGDIICEAVEC
FT                   SPTHLPMNADSDYAEITQCVRTTVFYSHQDTIIHIEVGCAVKLADMLFPSASGRINSAL
FT                   SQSNASIQARNPEAALPPGTQSESLVQDYDFAYFTLRGASVAGIRSVFSASICEAIEES
FT                   ELRRWEKHHLLTEVTDCITMQLWRAESQRGLIKLRVGHYTGVNLANNLYAEPRSCIAS"
FT   mat_peptide     join(complement(195482..195611),complement(194220..195308),
FT                   complement(193889..194151))
FT                   /db_xref="UniProtKB/TrEMBL:B6H161 "
FT   sig_peptide     join(complement(195666..195726),complement(195612..195616))
FT                   /db_xref="UniProtKB/TrEMBL:B6H161 "
FT   CDS_pept        join(196199..196377,196430..196543,196731..197117,
FT                   197178..197536,197631..197675,198036..198874)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948715"
FT                   /orf_name="Pc13g00810"
FT                   /product="Pc13g00810 protein"
FT                   /protein_id="CAP91150.1"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI000183103A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H154"
FT                   /transl_table=1
FT                   /translation="MAPPPWPPAQPGEHQFWTDPILCEETRARLEHFRSLGWLPPNFKP
FT                   KTLEGLAVVERYWRKYCIQLNEDYVEYLLLEDQAIYMNFFDWMSKTSRKKLLQRTKNKN
FT                   TLDVDVFCVTYRHHWVYSKHFRHGSMIIQFATIQLWSAITGTRPGVLLPQKASLAGMPL
FT                   GKRKGDKAFQSDLPKYVSTDDLPASVCYRDIELFYLKDPDSKRDVLCAIIEFRNLKGRP
FT                   EGADGTKYFMHGDYQLAYCPINQIVSLAFRDGAFLNTALTPELIWRLRVPKRSQSLPLR
FT                   WKPEKLDTPLLRRLERTTYGYELHKSLSMTYDSSRQALQELGRDARFEDDIGHYNYRRW
FT                   TANEVNRNFTSQERQRVLGQSARKEYFHTAPVLEVDRQIKQLLGQSDVDQSDAGSSEDE
FT                   DWELPAPDYVFPERVRLVENFYGPEAENFDEERLLARRIQVTKDMVALSQLCEPNRRGN
FT                   RINWDVEDDEIEKSEEPLPAEEESLECPTDICIICCGQSRLSSSNPPPHKFPAKRQDSV
FT                   RRHLIDSHLAHAHDGISCTWPACHGIAKFTKVTEFLAHAVTVHAYDINIKLHHLPIKPC
FT                   LTCSDTSSVDSTVESVESGGRSGTDTPASSVGPEMANIDPRLLEPDKPQVTDPLLRRSK
FT                   RLRLR"
FT   CDS_pept        join(complement(200533..200803),complement(199955..200448),
FT                   complement(199764..199892))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824598"
FT                   /orf_name="Pc13g00820"
FT                   /product="Pc13g00820 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91151.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="UniParc:UPI000183103B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H162"
FT                   /transl_table=1
FT                   /translation="MSFPPNAKPDPLEIERKLLRQHLGLGPNPGDPPADSPPQIQPLFF
FT                   IEMAPDSRRGAKCKLPTCDENIMPGELRLAMNPAMIYGGWSKSSASLYHIHCFEKLADF
FT                   THADFLDQIQPLTRQTWKLRGINAGSVLDGNYLVPGGVERLVLEWKVTHGKWIDKRDGV
FT                   CDESEEEKRVYADFLALLRKAGSSKYKQHMKPTGLPHDKYHNLLVTLAPYESDGPDDTE
FT                   EWNLFDTYLDSTVKAFNDPHDLSTMLQRWHEDVALVSKDVDGLDERGRAAKARLGAKAI
FT                   RALKRLSVIPMPSLAA"
FT   CDS_pept        join(201893..201901,201937..201953,202017..202326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948716"
FT                   /orf_name="Pc13g00830"
FT                   /product="Pc13g00830 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91152.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000183103C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H163"
FT                   /transl_table=1
FT                   /translation="MVHFKEENRGTIVLLKIEVEGVRPNIAYSTMPRKYSWVKKRRSET
FT                   AKAASQQKNRRKNTIYKRAAEYSLECKADTLVAIQIRKTGEIYVFDSTGGRWLGTLSRL
FT                   VFCTEVW"
FT   CDS_pept        join(203152..203246,203302..203626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824599"
FT                   /orf_name="Pc13g00840"
FT                   /product="Pc13g00840 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP91153.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183103D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H164"
FT                   /transl_table=1
FT                   /translation="MDDHITQRLSIIIKNNLHQSGAIAVRNTLVTRGAPYNRCRKPTLM
FT                   APEDVNKLVICHGEEGTASFCGSAVYGLGVEGSLDLYHGDARIASLHWNGPWARTGNQF
FT                   EATNVNSAKYLVNISGIPSHGILGDVSVIVTEVAC"
FT   CDS_pept        complement(204013..207624)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824600"
FT                   /orf_name="Pc13g00850"
FT                   /product="Pc13g00850 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91154.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183103E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H165"
FT                   /transl_table=1
FT                   /translation="MASTEQRLLSESRFSTILVNNLHCPSCVSTVNDTLFSLNPPPFSV
FT                   SVSIVLHEIKVAHPIDLSTSQIVHALEDAAFDIDSVVESGDSTNGGPESESLRTWRSTR
FT                   PSVVWRASDPDPHHESEQHIRQCDACSAQLATQSSRTGDDPPVIQKNLSPLVVESDSPR
FT                   DNDLVSVVDDHLTGTRTRITLSISGMSCSSCVGKITNALNDQPWVQSADVNLLTSSAVI
FT                   VLLDRSRVNEVLETITGSGYSAQLIDCEDLLPERQSKPSASTDIWRASYVIGGMTCSSC
FT                   VGTVTDTLNRYEWVTKVDVNLVSGSATVELQGKEHLEEVIAIISELGYAAALGEAERSA
FT                   PSEQRALNRSVTIQVEGMHCPNCPQRILDALSVFSNCLQVTDPLRKGRPRLTIAYTPDS
FT                   PNFTIRHILHAIAQADKAFTVSIYHPPSLEERSQMMQRRHMWRIARRLLLAVLTAIPAF
FT                   IIGIVYMSLVPGDNSGVMYLEQPIWAGRVSRMEWALFIMATPVYFFAADLFHRRMLSEL
FT                   VVLWWPGSKTPILRRFYRFGSMDMLMSLGTTVAYFSSIAILGINATQPADGLRVTHVES
FT                   FFDSVVFLTMFLMIGRLLEAYSKAKAGDAVSLLGKLRPTTAVLVASKEAEPSSPSVTPH
FT                   TVPIDQLELNDVVSVANGASPPYDGIVVEGTSRFDESSLTGESKPVPKSIGDEVFSGTT
FT                   NRANPVLVRITHLSGDSMLDQIISAVREGQVRRAPIERTADLITGYFVPLITLIAVLDW
FT                   IIWLSLGVSGRLPLSWLEGGAGGWEFWSLQFAISVFVVACPCGIGLAGPTALFVGGGLA
FT                   AQYGILVKGGGEAFQEASQLDCIVFDKTGTITEGVQPSVTDHKTTHEENIDEVWGAVLT
FT                   LEQKSSHPIAQAMVSFAGSRRPPALTASAVDEIPGKGMKGSFPLGHRPSSILDVIVGNE
FT                   ALMLDHGITILSANAAILTAWKREAKSVVLVGTRVREGAGDIEKVHWVLSMMLAVADPV
FT                   RPEAKEVLHALRNRGISVWMISGDNPTTAHAVGKIVGISPENIIAGILPEQKAEKIRYL
FT                   QKTVPRPSKRRWFNWGKGSRRTRPLVAMVGDGINDSPALTVADVGIAIGSGSEIAISSA
FT                   EFVLISSGLTSLLTLIDLSRIVFNRVKYNFGWALVYNCIAIPVAAGVFYPIVSNGNHIR
FT                   LDPVWASLAMALSSVSVVCSSLLMRTRLPLVGFRSAK"
FT   CDS_pept        join(complement(210496..210685),complement(209609..210462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948717"
FT                   /orf_name="Pc13g00860"
FT                   /product="Pc13g00860 protein"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91155.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000183103F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H166"
FT                   /transl_table=1
FT                   /translation="MDTELLRSLQRDTGDNTDTCEAGNEYDGRLGLRVSSIFVIMAGSM
FT                   IAAVFPVLVKRSSTVGAKSKYFGSGVIIATAFIHLLAPAEEALRDDCLAGPISEYPWVE
FT                   GIILMTIVAMFLVELMIMRHSYFGTSQQSDMVDDGGRCLGGVDNFGGRNQAKRHLPMDD
FT                   NLSREHKDAEVARGNFAFVDDYAAQLIGVFILEFGIIFHSIFIGLTLAVAGSEFTALYI
FT                   VLTFHQTFEGLGLGSRLAMIPWPTSRRWTPYVLGTVYGLTTPIAIAVGLGVRNTYPPSG
FT                   RTTLIVNGVFDAISAGILIYTGLIELIAREFLFNPFMRRTPLRTVWSAFLLLCLGAGLM
FT                   ALLGRWA"
FT   CDS_pept        join(<211811..211844,211897..211949,212006..212358,
FT                   212590..212884,212938..213081,213137..213481,
FT                   213538..213707,213768..213957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948718"
FT                   /orf_name="Pc13g00870"
FT                   /product="Pc13g00870 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91156.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831040"
FT                   /db_xref="UniProtKB/TrEMBL:B6H167"
FT                   /transl_table=1
FT                   /translation="ELPVGTTIHWHGILQRGTPDMDGVPGVTQYQIPPGGNFTYRFSVK
FT                   DEYGFYWYHSHFRAYYNDAIRGPLMVRPAPSRRRPFEDMAASTVEREQLLQAERDAVSI
FT                   LLNDWTHDLSDTIFSRYFETGAFPSCVDSILANGLGRVECLPSSDTMGESDTMGESMRL
FT                   GPRGCMPPMMFRPGYDINSLPAETCVNTTSQQLVVNANASQGWLALNLVNSGAVSNLKV
FT                   SLDSHSMHVYAADGLYVTPQEVKVLEIALGQRYSVMIELDQSPGNYYLRFATYPNGDMQ
FT                   QVLEGQAIVSYSTTGNDTQDILVDPMSVWMLTNGSATQDANELVESRLAPFEGNRPPTT
FT                   AADVTRFFNINQTDIVTWVVDQYPYAEPTIPIIYGNMSDGWNANTTLHSPTNSTVDIVM
FT                   NVANGSLDTMGHPMHLHGHKFWVLGSGSGSFPYQSVAEAPPSLINLDNPPYRDTANLPP
FT                   SGWLAIRYITDNPGAWILHCHIQWHIVVCQLPFFTLAIGGKTLTVGYTVWNGGGLSRGR
FT                   RSARCPNSAR"
FT   CDS_pept        join(215509..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216902)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824601"
FT                   /orf_name="Pc13g00880"
FT                   /product="Pc13g00880 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91157.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831041"
FT                   /db_xref="UniProtKB/TrEMBL:B6H195"
FT                   /transl_table=1
FT                   /translation="MLFPVPWGLAVSTFFMLQFTFSAALNGTIRTYYVGAVEEDWDYMP
FT                   TGIDLINGVEIDQSPQAAAVAAHNGQRIGHVYTKAMFREFTDDTFAVQARRPQWLGMLG
FT                   PVIRAEVGDTVEVIFKNMASNNHSMHPHGLRYSKPNEGVAMAGQEFSGNSVPPGETWTY
FT                   TWEVPERAGPGPLDPPSLAWTYHSDVSGAQDIYSGLVGAIIIYRPGELAKHTLDVPAPR
FT                   GSDLTEEVLTLFMIVDENLSFYIDGNTLNRTNIPRGELQVNRLDPGFQESNLKHAINGR
FT                   LFGNLEGLTLTVGRKARWHVQSLGNVQNAHTPHWHGNTLTWAGQRLDVLSVLPAQTRSL
FT                   TMTVDNPGVWVHHCQVLNHRSKGMIVKYHAVDQD"
FT   sig_peptide     215509..215580
FT                   /db_xref="UniProtKB/TrEMBL:B6H195 "
FT   mat_peptide     join(215581..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216899)
FT                   /db_xref="UniProtKB/TrEMBL:B6H195 "
FT   CDS_pept        join(complement(218269..218344),complement(218077..218217),
FT                   complement(217400..218019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128945"
FT                   /orf_name="Pc13g00890"
FT                   /product="Pc13g00890 protein"
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI0001831042"
FT                   /db_xref="UniProtKB/TrEMBL:B6H194"
FT                   /transl_table=1
FT                   /translation="MLIDREKWACAACIRGHRAASCSHSERPLTIINKKGRPVSQCLHC
FT                   RSLRESRSAHVKCGCGNTNRARNDSGTQDSYPQCNCARGERCVCALKKDPFPDLVPKPS
FT                   WPHSPVHEEGRNTLAQPESVVAALHEDYSRYPGRFNSIQISPSESAPEFQISDQHTRLQ
FT                   SNSAEDSLPANSVISPTDLSSFTNLSSTMEPDYSAPTALDNFSVQQTMAENLDLDMSSF
FT                   PTVDFPIITTSAGSINDINSEYLYREDMFTSTYTQSTPGLTGADSYTADWEGLYPD"
FT   CDS_pept        complement(218767..218922)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671898"
FT                   /orf_name="Pc13g00900"
FT                   /product="Pc13g00900 protein"
FT                   /protein_id="CAP91159.1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831043"
FT                   /db_xref="UniProtKB/TrEMBL:B6H196"
FT                   /transl_table=1
FT                   /translation="MRCRACQSKGVKRDLPRPRCSNCLDEQILCFYVAPLRLTMARSKK
FT                   QRSACT"
FT   CDS_pept        join(complement(221746..222025),complement(220889..221697))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948719"
FT                   /orf_name="Pc13g00910"
FT                   /product="Pc13g00910 protein"
FT                   /protein_id="CAP91160.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831044"
FT                   /db_xref="UniProtKB/TrEMBL:B6H197"
FT                   /transl_table=1
FT                   /translation="MSAGGIMDGRIPDLQALPTEILHLILTSLESWEIKAFSLVNRRLR
FT                   DVCLPYLFYRVRFNFSEAGLDGLQQLRHSVVRLHVKSLNYTVPELIKPDILSFETFKSE
FT                   MLTPKSYVEEAKELYDCGYPADECPPYMVIYETLRTICENQQEILENHKNIDVLSSVLA
FT                   ALPRLRELELDFCPSIDEPQWVDSYLSLGMTAKEVSNTYHIQAVTKALQRRPECIAPLV
FT                   TIELSSLDLPHYSSWELPKFPSLSGALELLLEHCTTLRITGDSAPLELLSRSTVKLRKL
FT                   ILGHVNISYTAWREFLETNRQTIISIGFYDTHLIRGLAEIQELSPKLLPAVLPGFAFST
FT                   KKSTDYWKMPYWETGWIIQLGS"
FT   CDS_pept        complement(223238..226462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948720"
FT                   /orf_name="Pc13g00920"
FT                   /product="Pc13g00920 protein"
FT                   /protein_id="CAP91161.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183042F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H198"
FT                   /transl_table=1
FT                   /translation="MARIDLHTVDTLQLYAPRASTVDRKTVKGKILSGEAFSDFSRTER
FT                   ATIWKNLRSQAACDGIIPSLHTFFRDINYLELCANAVKRLVVLNKQRPTVRSALVHGFR
FT                   SRRADHGCLIQTSDTTFRRQPGSSDEGLTSGYRQIWMYAMRHYPEMAKDVQGGPKANPT
FT                   RAKARAKADESVIHAMAALAKKLGFRTPPVKTIIRQSPDHQIARAALLKARKPDHYHYD
FT                   SGAFESLIEQIAGCFALAIPNEAAPVAHITSRVIKLKDRCGIPQEQTQQLDSPHIFLDT
FT                   LHSATVLQRNLSSLEVRRSVYYAFFGKSSATTSQSVPLGQSSSNDPLSPLFVPTDVPRL
FT                   QSESAHDHMSRSSFDEGSSNGRRDRSEIPEEQHRRQERQHAVEHGPLLVQEPSIQSSIG
FT                   ETSTISEVMDMYWDSSGAEDQPRPENVEQQPAASRGMDSDSEERECTEIDEEDLLRRAA
FT                   DGGPVLEDAAAVNHLTLGAPRDTDMSSILDEGAGGVDMDEDMNSSAQNQSVQDRLGMPT
FT                   TLSRQSSTTPPASRKKSRDTTWKPYDATQKGNRKATTKPLAAQGQSIAEGGMTNSEPSA
FT                   EQRSGLGPLQPIAEHAEQEITRPVNEPEYPEHISGGPLPAEAQEGIAGEQMVDGTELIA
FT                   EAGEEVHQGDRVARERADALTQLQTSGAREDHAPRPVTELPADLPSLITRLREEGSQLG
FT                   DEGVIPDNIGMQELPELKPATVDNLDGVGGGTAVGVVKPGLSQQETERHRADLPNPEQA
FT                   QRQAIERQEGEDLLFDVPVLEEPTDQAVEEDPGRPTLEVPDPLRPGSMPAGLSSDVPPE
FT                   RRVTVTFYVYERQAWKKMDMVTVSPTQLADAQIIAERYARDPSQYARFYDGRLRKVAVN
FT                   ECIRAAIDDGSFTVLMSFGKDLMVTRHLVASVAEIFKSTGSEWHNPYHPEKRLKANTGA
FT                   PSAGPVQTRKDASSRKTERRGRKITPRIADGPPQDVRPSRARSEADSQPVTIVFRVRDE
FT                   NGRWRVAYEVRVDDRSNPSQVEQLARKEARDRQATFYDKNLRKLTPTQCFEAAIEDDTN
FT                   TIFMNFGGELRMDEDTIRSIAREVEL"
FT   CDS_pept        join(complement(226959..227338),complement(226532..226871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128946"
FT                   /orf_name="Pc13g00930"
FT                   /product="Pc13g00930 protein"
FT                   /protein_id="CAP91162.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001830430"
FT                   /db_xref="UniProtKB/TrEMBL:B6H199"
FT                   /transl_table=1
FT                   /translation="MDLLTDTERQLTAERLFKYQGTAKIDLDQISLQPLMSREIDQKNV
FT                   ERLHNIFAKDGCQRFDIRNHVTAVVSRRHLERACRGAGLTPEELKTYQREYPHLSFRGH
FT                   QVQCLHGQHRLTAAEETLAPSDRPDLRTALVDEYANEKAPTDGEVYRKIRQYQHESNAL
FT                   FQNRWWCRLSPNKAKRLRQLTSKDNTYLCAAFDALLAIPGLWNGLSLGSLNTVMALKCD
FT                   EVGSTPRSLKAIPDSSS"
FT   CDS_pept        join(227642..228199,228352..228600,228648..228758)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977828"
FT                   /orf_name="Pc13g00940"
FT                   /product="Pc13g00940 protein"
FT                   /protein_id="CAP91163.1"
FT                   /db_xref="UniParc:UPI0001830431"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A0"
FT                   /transl_table=1
FT                   /translation="MDDRHLTQLYAESFKAQRPLSPTPTTVSAHKEFQGQSNHKLTKGR
FT                   KQQEKPEKSKNPLFGPAQDVRQSSSQSERQTAQAPVIRRGSPWHILKDLFTCDLAGPVS
FT                   IAVHKKGPSEVIAVRAFSKEKADVWLQVIQQTQHPNVISATEIFKDLGMTYFIVDDLPL
FT                   TLEHLVACDIFPSELQLASILVQVIPIPLFHLLTNMTAGLEHCIGRQPTQSQAQTLRAL
FT                   TNVTMFLMQKYLKPDGVIGIDGTRWRSDPLEFLSATASVATIQELRKHPLLTKHRWSAG
FT                   TLVGLARLCLITTRTFITKPWVQN"
FT   CDS_pept        join(complement(230709..230723),complement(230610..230657),
FT                   complement(230434..230518),complement(228977..230163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948721"
FT                   /orf_name="Pc13g00950"
FT                   /product="Pc13g00950 protein"
FT                   /protein_id="CAP91164.1"
FT                   /db_xref="UniParc:UPI0001830432"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A1"
FT                   /transl_table=1
FT                   /translation="MSSLPIHPRDVLSLNEDTCADLLQEAQMIESFEVQENRSNAEVDP
FT                   LESLGAVTSPKSDAAYPTPPLSVASPPLTSSNGRITQHQPIGTPLSTDSPYASLETTPT
FT                   GPATPFGSDAIYSSYPTPSTSYVNSPPAEESCTLQGLRIPSQSRFRYLQSGRAGKNGTD
FT                   FLEQIKIEKILSAEDSLLAQEPSRLLQPLLECSEAGILPSLKALRLPVEWKGKGGAVKY
FT                   YRLLEAVKEKTLVLSPLAKRIAQILFYLNCTWLEKHGQLGATVATFILNACPEEPNTPE
FT                   RMKSRRDNITGCHKRPGKRCWMLVACLGAGVLLHGADAIDTVYVPQRRLRSPQLTRTCS
FT                   INSNFTIPQLNIFITFVLRTRPGTVHLLRSLDTVVEAIMLGASIADLRGVFRGITDATV
FT                   RQAQLASASAADQEAWTEQMTEDIWQAMDAESIAKKKIPDIIRDF"
FT   CDS_pept        join(complement(232723..233298),complement(231875..232675),
FT                   complement(231575..231814))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948722"
FT                   /orf_name="Pc13g00960"
FT                   /product="Pc13g00960 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91165.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0001830433"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A2"
FT                   /transl_table=1
FT                   /translation="MDYKGCLCCMSSYPYSCCLVPLTVSPFRRMDPLVIYAITAGGIFA
FT                   VLLLIRTISLLAGCGHLFSLIVSQHLTLPFVIRRHRFLGPWTRAGVFLHLSYAAINIFL
FT                   LFFRIKSLTGAGRRAGELALVNLIFPLSTIHLAYLADLLGIKWNSCRKIHRATGWMAVA
FT                   LLSFHIIAAVQGQGFTFPLREQQNLFTMLAAISLGALALHSIPWFRQWSYEVFLRGHQI
FT                   LAGLFVYGTWQHLPLQSASSKIYLFVAVGTFVLTFLLELITLLYNNGLFAGNGTPRAIV
FT                   SFSAMESKEGLVVNAVHIRVLLPRRVKVQAGQYINLWMPSVSLCSWMQTHPFTVTSWSK
FT                   GKQDTVELLVKPCSGFTADLLRHAPAAAGSSVSFLALFTGPHGVSEKVSNYESILLLAS
FT                   GSGIAVAIPYLKKMIYGYNTCTSQVRRLHLVWQVESVDKMTPALSLINNLLKDDIMDDG
FT                   YILHISIYVSDGIEQNGLPFGRHKRVYIYQEVPDWQSIISLEASGNQVERLPNTWDEQG
FT                   RTLVMGEVPNFPRRIRANRPG"
FT   CDS_pept        233495..233746
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948723"
FT                   /orf_name="Pc13g00970"
FT                   /product="Pc13g00970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91166.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001830434"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A3"
FT                   /transl_table=1
FT                   /translation="MSKTEQKSSWVKKRRSESSRAKSQQRQRRKSGLFKKAAEFSLECE
FT                   SDVVVAIRIRRTGQTYIFDSSSQEEWLEALPRLVLYPP"
FT   CDS_pept        join(234510..234512,234567..234625,234676..234922,
FT                   234975..235034,235086..235138,235188..235386,
FT                   235433..235552,235681..235785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948724"
FT                   /orf_name="Pc13g00980"
FT                   /product="Pc13g00980 protein"
FT                   /protein_id="CAP91167.1"
FT                   /db_xref="UniParc:UPI0001830435"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A4"
FT                   /transl_table=1
FT                   /translation="MSLRQIYPPFGENPSGQATIDIIAVHGLDFIDMSGRCSVSSWREP
FT                   LDESGEFWPVAFIRAHGLRARLLLYEFDSVMTFGAAPESVSREADGLLHQISTIRPTDH
FT                   PDAPIIFLSHGLGGILVKQALVNASQGDRYCGINNATRGLAFFGTPHQAPSHRSPGVIE
FT                   TVFSLVSPRIPIRSPYSPELPIVQGFRDQVEDYQFISFYGDSDEAVPFSSAVMNLAGNR
FT                   ETQVRLSSNHEDLCRFYQGSDNYRKIANFSDLWTASPANFASTGEYSPDQSVSVLPNRL
FT                   "
FT   CDS_pept        join(complement(236457..236555),complement(236187..236336),
FT                   complement(236000..236089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671899"
FT                   /orf_name="Pc13g00990"
FT                   /product="Putative uncharacterized protein Pc13g00990 "
FT                   /protein_id="CAP91168.1"
FT                   /db_xref="UniParc:UPI0001830436"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L2"
FT                   /transl_table=1
FT                   /translation="MAETHLESWQNCSAEALKWGTDFERKPISVNLVCPVGTVYPGNTP
FT                   QYERTRGRKACQVLRGWEDGRTRTREANLFENYKRKANYMHPLNLRRYSRTIMTTWMVL
FT                   SGIEREAE"
FT   CDS_pept        join(complement(240459..240590),complement(240205..240402),
FT                   complement(239760..239792),complement(239567..239697),
FT                   complement(239321..239474),complement(238624..239274),
FT                   complement(237791..238525))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128947"
FT                   /orf_name="Pc13g01000"
FT                   /product="Putative uncharacterized protein Pc13g01000 "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91169.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI0001830437"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L3"
FT                   /transl_table=1
FT                   /translation="MSWFGNIFPCWGARKQGVHDLSAVPREMKPSRGSERNVKRSPWKD
FT                   RSSCYVNTVEGEAAENQHIGVEPDSMNFKADALSHTELDQGQVPSLSEIGRPFASIPKN
FT                   PALPPSQDPQAKLLYAVKIGPECLSEASRALIYKGATASYRWKGLNPISRSFFMFTLLV
FT                   AWDTGVDIWSASSEAQQRRNRSAEQRRRYRELEKQGGLGRGQTTMKCFPVMLEMPEEEM
FT                   KRDARTALYSIWTSSGPTVYSALKQMPMLEDMFLGLETEEKLILAFCDRAFRRADNLDI
FT                   ENSGFVRVSSVLASEFSSYATKRKTISSKLVSYYHPFLETVRKAADSLLSNQSGGELQL
FT                   TSASLSHMVDEIITIANDMNETGHVRDYYAPTDDIVDNRLKEIAREFIRQHKPRVESID
FT                   RDRIEQYTLRGVWKGEFLETAHAFVLRDWGLIFLFYTPLIRQPDTLRITWEQHELGELG
FT                   QNYASAIFQAPYPASYFDIKGHLSGYPANPAGAVASMLQSIPPDEVFINNVPAPRISQS
FT                   KDIVAINREPSSIRASLLVVSCFGLLLVRRSWGENQDELVIPSGEVFAGEKPSDGGKRV
FT                   LEEKTGLKGELSLIDFDKHTGTMDDRSWYQPNYRVKLNHEWSEIPLSDKDQNFEWVQDE
FT                   KDLESFPGQGKLKLAPEWREIAQKGLQLWKETYDPGIKRKSQ"
FT   CDS_pept        join(complement(243017..243449),complement(242717..242967))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977829"
FT                   /orf_name="Pc13g01010"
FT                   /product="Putative uncharacterized protein Pc13g01010 "
FT                   /protein_id="CAP91170.1"
FT                   /db_xref="UniParc:UPI0001830438"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L4"
FT                   /transl_table=1
FT                   /translation="MALGIIRDKVISLKNHGLSIEDRKVLKEDRRLLFAWVDEAPNDRE
FT                   TPVTKWRKARSRKAYRTIQDASEQLFLAAILSITPTQCARKSFDRVLESLMRLNHEEFY
FT                   FTLGPETKSFLEAIAAEQGFAGNRQYLAFMKSLFPRIEPRQIQFAYSLVRRNDIPSFLG
FT                   KMLEGITSSQEWAKEESQGGNTTGCVTIIIPTNEHEDGSCNIRVNRTLLMQAIHDFRIT
FT                   SLKLE"
FT   CDS_pept        244929..245282
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948725"
FT                   /orf_name="Pc13g01020"
FT                   /product="Pc13g01020 protein"
FT                   /protein_id="CAP91171.1"
FT                   /db_xref="UniParc:UPI0001830439"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L5"
FT                   /transl_table=1
FT                   /translation="MPSKTQKSLEALMAYIKQSKSRRTTILRGQGEPGHRAAPARGGNH
FT                   DARIGSRIDIGEIVKKTGKEYRRYKFQLNSNAEDSTLKRKAAQDSHKVYSTADVEIKES
FT                   RTQEEEEQAMRDF"
FT   CDS_pept        join(246066..246090,246141..246436,246495..246873,
FT                   246953..247830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948726"
FT                   /orf_name="Pc13g01030"
FT                   /product="Pc13g01030 protein"
FT                   /protein_id="CAP91172.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183043A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L6"
FT                   /transl_table=1
FT                   /translation="MDIASSQTDWNSNDEFFKFTRGRFIVNEAENLRKREIRFDLNSLA
FT                   RVAADSVGAGRCIAIKKYPDGMFNKAYLMCMDDGQEVIAKVPNPNAGVPHFTTASEVAT
FT                   MDFARKILDTPAPRVYTWNSQAKSHPVGAEFIIMDKIKGVPLSQVWSTMKLPQKLQVLL
FT                   AMTRLQKQWLSVTFSHYGSLYYTEDVRPPAGNHFVKDGKVVKDSEFAIGPATGRDWCDA
FT                   GRSNLDVEKGPFGAREVKATQSLEPPKPIALFCGPKLYRPDTEKKITALAWYRQVVGAL
FT                   IPKDTAITRSCLWHNDLHDDNVFVDPDNPAKITGIIDWQSCHISPLFNHNPDPAFLSWD
FT                   GLEPETLDLAPQPKLSGLSPEERSAAVHEYTLQNVFIGWRKLMHAKNPDLYRVVEFRRT
FT                   AAYGLIFLAHRMFEYGEAHFQSLLVDLKDTWTDLPAISSDTPFPFDFSEADFERIKLDS
FT                   NGAVAGTDLVAEVKERMGDLWPDKGFIEHERYDDCKAALHEVKGLILEQLAENDQEKAE
FT                   YERFWPFE"
FT   CDS_pept        complement(247993..248463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948727"
FT                   /orf_name="Pc13g01040"
FT                   /product="Pc13g01040 protein"
FT                   /protein_id="CAP91173.1"
FT                   /db_xref="UniParc:UPI000183043B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L7"
FT                   /transl_table=1
FT                   /translation="MASIFRLPSRISRQTFSWRSSFLRSVSPVREFSQSSFPLLDPTQK
FT                   FEEETLSGYSPDGFYPVKIGEVFQSRYQVVGKSWRHGSRGESCNIPFNGKDVIPTLPGI
FT                   RHGGFKGTPYMIQNFHEVFQDQPGPPRGLTEWLESWEAGQELEDVPDDDLQE"
FT   CDS_pept        join(complement(250004..250298),complement(249173..249939))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824602"
FT                   /orf_name="Pc13g01050"
FT                   /product="Pc13g01050 protein"
FT                   /protein_id="CAP91174.1"
FT                   /db_xref="UniParc:UPI000183043C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N2"
FT                   /transl_table=1
FT                   /translation="MERQVSYNSPLSAAPPPPINHPLPPKPPISMHFHAYTPHSLKPVT
FT                   PICEMAAQYVNQGQTISVNNEPKGPSLRRHTTVSSVGVTSSLDMESVIRPFGADTSLRL
FT                   ENDDSGATGSINGDDFPHPDTLWSSVANSRVSSDGPRCADDGSCPDEASATASEDHGTG
FT                   SWSCGSYTCDTDDVGQYDNDQTKHLTDGRKDGSSDTLGPDTLAASGLLVEESQPSLSGN
FT                   ENTHRVTEISICSTPQIPQPTFRSQKKPACIVSRDTEGAAPGGPRTRARARAEASLFSV
FT                   RRRGRPFSAVEDALLRELVGRKLAWERIEQEFGRTFAERGLKSLQGRWSRKLKFLACPA
FT                   KRTPDALGRRSSS"
FT   CDS_pept        251592..252110
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948728"
FT                   /orf_name="Pc13g01060"
FT                   /product="Pc13g01060 protein"
FT                   /protein_id="CAP91175.1"
FT                   /db_xref="UniParc:UPI000183043D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N3"
FT                   /transl_table=1
FT                   /translation="MELHMLSGSEDRHPIGASDLVTKLKWQLDQDLDHNCTPLGPCGSY
FT                   DAPFKITCATFGYTVVGKGTTSRLWGEVSREAEVYRVLQRTQGSAVRVFLGAIDMAQIY
FT                   FLHGAGKICHMLLMGWGGLSVSHMTLDKTIQHASVKEIRSLGICHQDLRPENILWNAEL
FT                   ERALIIDFH"
FT   CDS_pept        join(complement(252897..253019),complement(252793..252844),
FT                   complement(252644..252708),complement(252423..252599))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948729"
FT                   /orf_name="Pc13g01070"
FT                   /product="Putative uncharacterized protein Pc13g01070 "
FT                   /protein_id="CAP91176.1"
FT                   /db_xref="UniParc:UPI000183043E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N4"
FT                   /transl_table=1
FT                   /translation="MQDITEVPPGSKPYLSYQETPPKGIGLDNLVDDISHACLSQARQC
FT                   DISFGALSRGAGPSFPSWHLGISEISVLAPNAELKGLRSHRGPMASIMRAACRYLSPAD
FT                   KNLLADADLPLSIAEKDNMARHGYQIRRWRRSVS"
FT   CDS_pept        254332..254996
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(255884..255979,256035..256323,256361..256399,
FT                   256530..256721,256783..257028,257482..257639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948730"
FT                   /orf_name="Pc13g01090"
FT                   /product="Putative uncharacterized protein Pc13g01090 "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91178.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183043F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N5"
FT                   /transl_table=1
FT                   /translation="MAGDFGLQRQCQTCLAIFPTNDALRYHLEVYRLRERTLTLEIEKC
FT                   RAHAAPIYDPNKLCESCQVNAALTVASSNVSYQSDGEKDNGKDSISETTATLRSLGRRV
FT                   SKCPYYGCGKPFGSRKGLLKHFELPNRGFGTRRRLQRTIMKLDQMIETLESSSNDADLK
FT                   TPKRTLGETDLGQNSCPLRRVRARCKNGEALLDTTSEKAPQHVELQDKPFTSFELQPAY
FT                   EAVDMFAPLLFHDCPPPPTDNFDPPFFEASSSVGYRTQLGDGDPVGFCADITDPIPETE
FT                   FRFAWDENNFRPTTPQFHDQNMPARLLTPTSELKDVPWITVEFPVPGKTARRKKGLED"
FT   CDS_pept        join(complement(259844..260168),complement(259558..259783),
FT                   complement(259323..259344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948731"
FT                   /orf_name="Pc13g01100"
FT                   /product="Putative uncharacterized protein Pc13g01100 "
FT                   /protein_id="CAP91179.1"
FT                   /db_xref="UniParc:UPI0001830440"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L8"
FT                   /transl_table=1
FT                   /translation="MPRLQLPSNRSPGLSLIFKDYAMNQMKGTFDSSTTPNNLRLSWLT
FT                   KALRYTQEEAEESLERLHISTIERLGSLDDMIMGGLVDQPLTEIDIKNETILMVSWHWD
FT                   KCCDGSCPYSNRVTPLIRKSKRSLSKRPCAPIFQRKRSHRRRNIAQRKAIMKEKRRCRR
FT                   LRSIRLTLYTGRLLARRYWFYYSNILP"
FT   CDS_pept        join(260191..260266,260355..260428,260513..260644,
FT                   260928..261041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948732"
FT                   /orf_name="Pc13g01110"
FT                   /product="Putative uncharacterized protein Pc13g01110 "
FT                   /protein_id="CAP91180.1"
FT                   /db_xref="UniParc:UPI0001830441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L9"
FT                   /transl_table=1
FT                   /translation="MTAERRKLACICYVADDWRKLESTAVRTISFHRLGEMPCCEPIMS
FT                   GHGLPDQPLTRIFVPDPGRFGLKRKGSVTPIGYRLKHLARCCISDKGPQPVYVRPAILA
FT                   SPHIYGRDRASPMENTGIFDHRDASTY"
FT   CDS_pept        join(complement(262609..262753),complement(262476..262544),
FT                   complement(261640..262418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671900"
FT                   /orf_name="Pc13g01120"
FT                   /product="Pc13g01120 protein"
FT                   /protein_id="CAP91181.1"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniParc:UPI00018304FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M0"
FT                   /transl_table=1
FT                   /translation="MNILDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDIYRA
FT                   SEAEKTRPEWWPLGVMHKEPDHLRKEYRIGLLLHIIRKLGPYGITANKLKDVAGDTERS
FT                   LKHPSDVEIIYEILQVRKMEERLERGEADANMIVYITSRGPSREDDKEDGSAISVATEE
FT                   PEHINLELMNPIPSFEQASTSLNTPTDSIPSACSLPGRFSKAEPLNFQNPAYDPPSYAK
FT                   PQQYSDSSSEPMLSTPMAAEIISPHNASALAFDYSAQTYPNSTSGVTGHYDNWTPYFRQ
FT                   NIFSPIDYATPVSSQGMPHVNELPVSHRRAHLPNMDTIHQRSLFLRTEP"
FT   CDS_pept        join(complement(265326..265400),complement(265081..265284),
FT                   complement(264516..265047),complement(264238..264463),
FT                   complement(263715..264172),complement(263108..263661))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977830"
FT                   /orf_name="Pc13g01130"
FT                   /product="Pc13g01130 protein"
FT                   /protein_id="CAP91182.1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI00018304FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M1"
FT                   /transl_table=1
FT                   /translation="MPMIKLRRSAARSSDHLEIKRGYLKKAEDLTRGELRELTTHDEYT
FT                   VYFGCHYFTIHDSPCTVYGESWHTPCQKTVDRPTGLCTLYGKYALNFLIGIVSNRNSTS
FT                   DYDDDMKRAKSLGIDAFALNIGTDPYTDQQLQLAYDSAADNDMKVFLSLDFNWWHIEQA
FT                   AEVGQKVAQYASKPAQLLVDDKVFVSSFAGDGMNVAEMRVAVGKSVFFAPNFHPSTGID
FT                   ITPVDGLLNWMAWPNNGNNKASTAEHSISVADGDKEYVDALGGKAYIAPVSPWFFTHFG
FT                   PEVSYSKNWNFPSDLLWFNRWNEILELKPRFIEIVTWNDYGESHYIGPLSSPHTDDGAS
FT                   KWVNDMPHEGWLDISKPYIAAFKAGQSSPDSHISSDELVYWYRPAPRGVNCDSTDTCMV
FT                   PANNDSGNYFMGRPDGWESMADSVFIVSLLTAPATVQVNSGGTVHNYEAPAGASAKEVP
FT                   MGVGAQSFEVNRDGETILSGTSLKEVIDGCVCGLYNFNAYVGTLPPGSNDVLQPEGLSA
FT                   FTQGLRVQTCQPTPSLGTVPPPAPSLSKSTILPSSPPGVTKAPEPCSAILSTVVTVTVT
FT                   EAMAPPNSPPTRTCGGGGGEGGGGRNRACIAGTGANNYSGLCSFCCSYGYCPSGPCTCT
FT                   NYGTPIPLPPSTGARGAPLIGEDDSYLGLCSFACDHGYCPPTACRIA"
FT   CDS_pept        join(complement(266620..266739),complement(266287..266487))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824603"
FT                   /orf_name="Pc13g01140"
FT                   /product="Putative uncharacterized protein Pc13g01140 "
FT                   /protein_id="CAP91183.1"
FT                   /db_xref="UniParc:UPI00018304FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M2"
FT                   /transl_table=1
FT                   /translation="MTSVGKTIANVSHERNRVREQEAKPSGSFIPTPKRAIQEQGPDHD
FT                   YDFGTAHKAKTVLPVFVLRQHGKRPDWVLIRWPQGDEPLGAQLADLHNALPRPNAPIRK
FT                   EI"
FT   CDS_pept        join(266741..267477,267712..267882,267933..268036,
FT                   268088..268113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128948"
FT                   /orf_name="Pc13g01150"
FT                   /product="Putative uncharacterized protein Pc13g01150 "
FT                   /protein_id="CAP91184.1"
FT                   /db_xref="UniParc:UPI00018304FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M3"
FT                   /transl_table=1
FT                   /translation="MAPQIPEEDHCGHYFETFTQEITSDCGCLETPRENVKGNASCIIS
FT                   KFKFAQTPTCLSLGLIMIGIVGARLFVNCMSQDESHYHHLEGENGGLEDAVTVIENIFA
FT                   ADRQSMEECGLQPGEFKILDKAIISQYSDKDEQILRAETVVYCHIEKVSEKFNNSPNAI
FT                   IEKLFASGWVELEKVDSPLESRCELNREKLGMPETRIASIYKAFILVKCLVEGKHLYYT
FT                   GGSRADSRFANPQAFGVKPALGFSPSLMYLDKEEKRDPYIQSSGLYCDKSLDFGERVST
FT                   PDDFKSFVKWATVPRSKTVVETWNKRESKYKIVEPIDTSDELDDDAGYVFVARKRVDRA
FT                   PSERR"
FT   CDS_pept        join(270126..270150,270180..271450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948733"
FT                   /orf_name="Pc13g01160"
FT                   /product="Pc13g01160 protein"
FT                   /protein_id="CAP91185.1"
FT                   /db_xref="UniParc:UPI00018304FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M4"
FT                   /transl_table=1
FT                   /translation="MKRVVRKIVKILSSRRFHVTYHLLCRWQTGLEFFLYQLCKTTAPG
FT                   LIDDCHWSCAEAAELTRLSEKVTEFFCFHHKPIFKDCGISEQERESFCSDLQEIRQIRH
FT                   CAVHRVDINAATINKYAKCALHVLGTIKRLGGQGFRKDHGEAVCPVPFPSHYNNRSPRH
FT                   ELQLDRFVNSFWETERHLILQASSHISPSQHEEQNPGHNSKKAEGARLREAQQDDAQPT
FT                   KAKEAEHSQKHHDDAQPTKAKKAEHSQKQQDDAQLKKAKKAEHSQQQQDDAQLKKAKKT
FT                   EHSQKQQDDAQLKKAKKAEHSQQQQDDAQPTKAKEAEHSQKHHDDAQPTKAKKAEHSQQ
FT                   QQDDAQLKKAKKAEHSQKQQDDAQLKKAKKAEHNQQQQDDAQLKKAKKAEHSQKQQGDA
FT                   RPKKYMRTVNIQKICASSNMCKGKSTICTHTT"
FT   CDS_pept        join(complement(273155..273482),complement(272976..273100))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948734"
FT                   /orf_name="Pc13g01170"
FT                   /product="Putative uncharacterized protein Pc13g01170 "
FT                   /protein_id="CAP91186.1"
FT                   /db_xref="UniParc:UPI00018304FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M5"
FT                   /transl_table=1
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKRNYLLREYRSMQESLSETT
FT                   SSGAVPLRAQRDEARMSCLPSLPIYAPRGSRTKTRILIHALEQLAVSERRHLTNDSDNA
FT                   NERLPGYTIQPPHTLRPAPSRHISYHWKFVHRMAAATRASRNAEIL"
FT   CDS_pept        join(274537..274865,274922..274939,274989..275181)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948735"
FT                   /orf_name="Pc13g01180"
FT                   /product="Putative uncharacterized protein Pc13g01180 "
FT                   /protein_id="CAP91187.1"
FT                   /db_xref="UniParc:UPI0001830500"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M6"
FT                   /transl_table=1
FT                   /translation="MGDQRNSQRYVDRMSQLLSSGSPEPNNIWSPPTSIAGSVDDDCHS
FT                   QQTDVSDEEGKATSMDGCSDEEGTRGQRAKEHTKERALDGARSVKFLKPEDSTESMVQM
FT                   IECMAELDERVQSDAKSLEGQDRWNQGMQRKYIDMIGAIDTLSKDVATLRKQVEALSSR
FT                   DAAKTREVVGSKRQKQ"
FT   CDS_pept        join(complement(276753..276851),complement(276595..276690),
FT                   complement(276433..276515),complement(275920..276064),
FT                   complement(275486..275533),complement(275222..275383))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977831"
FT                   /orf_name="Pc13g01190"
FT                   /product="Putative uncharacterized protein Pc13g01190 "
FT                   /protein_id="CAP91188.1"
FT                   /db_xref="UniParc:UPI0001830501"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M7"
FT                   /transl_table=1
FT                   /translation="MAGCWRACVESSRLRDATRWDYGHLLRDNDMNMYVPARYRTIDAI
FT                   LAVGFRGTLRNPNQGPIRSMPGDLHATVVQTGLNTAVFIRPGSLQFPGAVSKRNGDYNI
FT                   DCANGFGIQPLPSAETSARMAMANFDANADPLANADRGTVDMPRKAGQFDSIRRSTTVL
FT                   SPTHGDKSLSWYVTNCGSGAELDRRRHVTSVTARRRPKDYFTWKQSS"
FT   CDS_pept        join(complement(278221..278376),complement(277592..278041))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948736"
FT                   /orf_name="Pc13g01200"
FT                   /product="Putative uncharacterized protein Pc13g00520 "
FT                   /protein_id="CAP91189.1"
FT                   /db_xref="UniParc:UPI0001830502"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /transl_table=1
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
FT   CDS_pept        join(281390..281521,281569..281826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948737"
FT                   /orf_name="Pc13g01210"
FT                   /product="Pc13g01210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91190.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830503"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M9"
FT                   /transl_table=1
FT                   /translation="MTENTPLWAIEEGSSSQSQIPRPPVEKRRNVSLACIECRQKRIKC
FT                   SGTTPCANCTAKGCQCFYGSDRRRKAHSIESSMLHQALLYTVVKLRSGNPDTVRSFVLQ
FT                   IRALQSARDGTSFLLSESRQDDQAV"
FT   CDS_pept        join(282432..283111,283167..284121)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948738"
FT                   /orf_name="Pc13g01220"
FT                   /product="Pc13g01220 protein"
FT                   /protein_id="CAP91191.1"
FT                   /db_xref="UniParc:UPI0001830504"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N0"
FT                   /transl_table=1
FT                   /translation="MSPSTQSPSNASQCVAPSSVDSDGLKKFLKLVSMLASSPESQTMS
FT                   AILGEIAYQREQVHARDKELKKAQDQVLDLEERKRVTIEEMFAANEGEKAKQKDALDRV
FT                   ESLRASVNQKDKRLAEYSKEVQGLRQQVDSIKSSYSLELDKVSQSAKDISTLQQNLEEK
FT                   DKTIDRMKAAGSSLKSMFSSAQKKIEELEAEKACLDQALQASQGQLQTLQSFTVQQLEL
FT                   DENSIMASFSDLWVFASSEVFAILREDLDEEVLKVCLCLNPNPLYNHIHSSFDQKDKSI
FT                   WDKLRKENTKIAENNIPLVPSNSLEAKGMRLAMTMAFLSRELCKYIFQPNYLFPDDSEI
FT                   RGVLSHLAENNTEKESFCRRVLLSIDHSAEEKIRQTRIQTVIRNVSSYLWALLSQTQHD
FT                   SIRISIEKIVQKAAGFWLPIQRAQQRYETEFELADFEIADCEPFHFPGDSALPDRQDQG
FT                   ARDMNVLTVFPCITLVKDGDRDPLTHLIQLRSSQKLFVAAEHEASQMTTSFVVPRRSST
FT                   RSRRKSIAHNTDRPNGASFLGGKSPQP"
FT   CDS_pept        join(285772..285774,285991..286290,286337..286798)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948739"
FT                   /orf_name="Pc13g01230"
FT                   /product="Putative uncharacterized protein Pc13g01230 "
FT                   /protein_id="CAP91192.1"
FT                   /db_xref="UniParc:UPI0001830505"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1"
FT                   /transl_table=1
FT                   /translation="MRVSKSFNSAFSSSVFGLGSGYSCFRRFLDHPGAFRRVLRCGAVV
FT                   TGPLVFQYFAKQYVDDVEIDILVSYDQSHTVTQHLQQSEGYEMVDEECSPFTETLKVSR
FT                   FKKERKTVRVSAIRNLTPLAFFLTHERTTACFNFLTEDYGYCLFPMSMRRKLDYRVCPV
FT                   LEEIEYGWLPEPQDGWTFYADFPHDGVTVSDHYAMVPVDMEIRTDRWIGDRFTWKVKLF
FT                   TDSPAEGVEKREYAFFVKSQSVHLGSWNETEQ"
FT   sig_peptide     join(285772..285774,285991..286050)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1 "
FT   mat_peptide     join(286051..286290,286337..286795)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1 "
FT   CDS_pept        join(complement(287421..287570),complement(287100..287316),
FT                   complement(286905..286993))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128949"
FT                   /orf_name="Pc13g01240"
FT                   /product="Putative uncharacterized protein Pc13g01240 "
FT                   /protein_id="CAP91193.1"
FT                   /db_xref="UniParc:UPI0001830506"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N6"
FT                   /transl_table=1
FT                   /translation="MDLPWFYCADRCSDEEGTRGQSENEQTKERISGGGRSIKFLDPEY
FT                   SAESMVSPEDRTRIPTLIRFRLDAKSLKDQDLWNQGMQRKYIEMIGTIEALSKEAAALR
FT                   KQVEVLPSGDAVKTRETVGLISHGAPGYSNNDKRTPPTGKFKVHVNV"
FT   CDS_pept        join(287709..287763,287853..288094,288187..288414)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948740"
FT                   /orf_name="Pc13g01250"
FT                   /product="Putative uncharacterized protein Pc13g01250 "
FT                   /protein_id="CAP91194.1"
FT                   /db_xref="UniParc:UPI0001830507"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N7"
FT                   /transl_table=1
FT                   /translation="MYCMGSKETRHMYTRTCIVPHVWQARPRVHGCSGIPAGREGIMHI
FT                   IFVPLLAFTSLACYIIGSKLLILYHVPTSEYMYDAFVASLLFTHRPGLFHNLWQLIFVS
FT                   VPGAIVVGHREIQLLLSLKCTVQPETTGNREIRDIECKNGIVEYGETPPSSLTVRSNPG
FT                   LDFERRGKFLE"
FT   CDS_pept        join(289563..289610,289937..290024,290128..290312,
FT                   290405..290779)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948741"
FT                   /orf_name="Pc13g01260"
FT                   /product="Putative uncharacterized protein Pc13g01260 "
FT                   /protein_id="CAP91195.1"
FT                   /db_xref="UniParc:UPI0001830508"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N8"
FT                   /transl_table=1
FT                   /translation="MRPGTPFVLGLPPSASGVFNRKYKDIQPSQGIHLLSLVVNEAVHA
FT                   VYPSLFSPIPVFYNLDSDELWNPNKSMDSPPSPSQSGRANKRKRASPDQFVIPVGMPGR
FT                   SEQTIPAGAACSLTRNMSQILQSHPSLKSSSAVDLLDLYLCLWECYTIKSAGRIRLEEE
FT                   RRFLQDSNKWLVRENEKLQEYCNHQELLLWDHRQAFVSVHQGVLGTLQNSDRPSRQISE
FT                   LQWDRAGAN"
FT   sig_peptide     join(289563..289610,289937..289939)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N8 "
FT   mat_peptide     join(289940..290024,290128..290312,290405..290776)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N8 "
FT   CDS_pept        join(291831..292588,292691..292769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948742"
FT                   /orf_name="Pc13g01270"
FT                   /product="Pc13g01270 protein"
FT                   /protein_id="CAP91196.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830509"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N9"
FT                   /transl_table=1
FT                   /translation="MSVQLDNHQSIINYCRSCPEDQLTGGLRSGNQVVKLPDCDLVVKF
FT                   GPFVSSYEAKNQQKAYGIINPDIVIVPSVHKFFVDDEGWGYIISDFIQGKIIEPLSDSH
FT                   IHRLAHILEYFRSITANRAGSLCGGPSVGLLFPDTNDLTISNVQQVEEWFNSRLFPGDG
FT                   KVHFDPTPLVLCHLDIAPRNVIWLDDGRVCLLDWASAGFYPRLLEFASLFFQEYRFSEM
FT                   LLKAVGFDYGRDKEEQQRICQALYNNERYSFWLHLSSSITSGTAKTSDLTRRKWYW"
FT   CDS_pept        complement(295236..296234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948743"
FT                   /orf_name="Pc13g01280"
FT                   /product="Pc13g01280 protein"
FT                   /protein_id="CAP91197.1"
FT                   /db_xref="UniParc:UPI000183050A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P0"
FT                   /transl_table=1
FT                   /translation="MERIASGFGRYLPIAEANNLIRTALLNVPFTQDVQVAGIGTTKTG
FT                   YVIRFKDTASAEAARENNEWLRELGNETELVKPRFGAVVHHVPTEDWTSSETKKELFKR
FT                   SWKRTTSRNGGFRIEYIGSYARLPLAEALKTMSLERLQELEMIDPTPLPPWRTEAFSAI
FT                   EIEPDRETAIEQAKAAGSKSDVILYSDASGHNGHLGAAAIGFNKNSPEATESLQIQVGP
FT                   MDRWAVHAAEPLGVLQAITLINNIALKHRRSMDTRVKSATTLSDSMSDLQAIQNPGNKS
FT                   GQQIIHTILRAVTNTKTHGIAVRLQWVPVLYISRICTYIVSHFLKTNLEPR"
FT   CDS_pept        join(complement(298633..300722),complement(296847..298504))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<300926..>301906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000136556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824604"
FT                   /orf_name="Pc13g01300"
FT                   /product="Pc13g01300 protein"
FT                   /protein_id="CAP91199.1"
FT                   /db_xref="UniParc:UPI000183050B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P5"
FT                   /transl_table=1
FT                   /translation="PAGAPEPLPTNTQESTSSFSIEDFQPRVTASSLGSLPDSRKRTRS
FT                   GDAFTPSESTGRATTREVWRLIDSLKTIIHHQTTLIESTEAELQEVKHDQNVLRDQNEN
FT                   LHEEVRALRTQIEILPQAAPTRSWATVAASGGVRPPQLTHQRPDKDQNCVRISTQRLLV
FT                   DPTDNHNGDRNTFGRYLPTDSANTHIRMALLSAPSTQYAEVAGIGTTKTGYVIRFKNPT
FT                   SAEAARNNTDWLNELGNSTKLVKPRFGVVVHRTPTEDFDLQNASQQAIEKIMDEDELTE
FT                   RGFRIEEVAWLKKKDKELGKFASLGIWFDSAEGAEWLLVNGLLVGQ"
FT   CDS_pept        complement(304368..305837)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948744"
FT                   /orf_name="Pc13g01310"
FT                   /product="Pc13g01310 protein"
FT                   /protein_id="CAP91200.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183050C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6"
FT                   /transl_table=1
FT                   /translation="MPLLGLPLEILLWVGKFTDEKGLRTLCLTSREFNVIFRKSLFDCI
FT                   DFQDSPPIHWAIEHRSLGILQHSLGWEKADINEMYSGFTPLMLATQLRYADAVDLLLSH
FT                   HSVKVIQCNTLGESAFSIAVLHGSVKIVERLLNVQNVDLNNQSLDGIAPISVALTCRQT
FT                   YVFQLLLSDERTNVNICDHHGQTPLHLATEIGDYGAIQMLVRNPRVDVNCFNHRQETPL
FT                   LLAVKGHGRFLPIHKRLLIIEALLLSPCLNLNYQDENGRTAIWYAVSNSDLKLVELLLQ
FT                   QTNLDLNCADKLGQTPLAKAAANGSLDLIKVLFRQPGLHKSPSPQFTDAFPPLWSACRA
FT                   GQFAAVEFLLQNSADINQISPSGTSPLEVAIIMEHVDIVHLLVSSEKSLLINDQNHCSS
FT                   FTALMFASALGKVEIVKILLEHPNINVNAVDDQGRTSFWWAAAGGHYEVVQLLANRRGV
FT                   KKRLKDSNGQTAYAIAEQRKHGHVMVYLRSL"
FT   mat_peptide     complement(304371..305783)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6 "
FT   sig_peptide     complement(305784..305837)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6 "
FT   CDS_pept        join(complement(309564..309759),complement(308505..309505))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948745"
FT                   /orf_name="Pc13g01320"
FT                   /product="Putative uncharacterized protein Pc13g01320 "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP91201.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000183050D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P7"
FT                   /transl_table=1
FT                   /translation="MVTLNHQSFWQPPTTKSPQRCSSICSETQTVVITEELNASGESCE
FT                   GGYCNLENNVPQEEHRAEDVASEIGRLSPSISPNVYQSDASAAKNYPDYPQEVALYPSS
FT                   RVSSTPSVTGLDGPGTARVFDVFEDDDNRNLTANGSKCAWEDLNSSYPKRPRCLNSTAM
FT                   NATKSRRRRTSQPKAEGSSFESEESYADNLAGLGNAIRYLKRFYSLATAEAKFSDDLAD
FT                   ADILKENLAVLQVATKTLQHAYGIIATSATVIGDPVQQATTVQARHTITRRKWSVEDDS
FT                   RLLKLRDSQKLPWSRIRDLFPGRTLSAVKQRYVRETSKQIETPAGKDNHSNLSDQHVKR
FT                   TSNIRRSQRLCRPHQIKNTRSDAERHRRYPSRAVKHSGDSNAMKLDSIDPRLRNLGQT"
FT   CDS_pept        join(309937..310111,310204..310327,310479..310554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671901"
FT                   /orf_name="Pc13g01330"
FT                   /product="Putative uncharacterized protein Pc13g01330 "
FT                   /protein_id="CAP91202.1"
FT                   /db_xref="UniParc:UPI000183050E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8"
FT                   /transl_table=1
FT                   /translation="MEMRPPTLSVQLLSPLLWPIKLVQSRCGSTEGSDPRNNSMVLTMW
FT                   RGGGLLVRNHTDTVYDGPGIEPAPDIENWDNKRIYVRVIEWTAGQSLRVEGKSGCADIV
FT                   GAFERTMMQVEIKQADQSEH"
FT   sig_peptide     309937..310011
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8 "
FT   mat_peptide     join(310012..310111,310204..310327,310479..310551)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8 "
FT   CDS_pept        join(311236..311849,311904..312720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671902"
FT                   /orf_name="Pc13g01340"
FT                   /product="Pc13g01340 protein"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAP91203.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI00018305D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P9"
FT                   /transl_table=1
FT                   /translation="MGTLLPGKPLTALARCTRPTSNVNASMALRFTSTLQAHAQAKTAT
FT                   SPSLPPLSVLPARVLLRSLLVSTISSKRVLPIPALSLMSFLSKPNRIWLFDVDRNPVLH
FT                   GILKTTFYNQFCAGENGAECRSTIREMKDMGFRGMILTYAAETVFDHSTQAQSGQGVAA
FT                   LKSENGDVAVEASVHCPSIEAWREGTVETIYMTEAEDYIAVKLTGAGAKVTEAFTAGEL
FT                   PPHQMMDALHEVCTKAKDRKVRILIDAESQHFQKGISRVAVELMRKYNRDGYAAIYNTY
FT                   QAYLKNTPATLANHLALANEDGFTLGLKLVRGAYMATDERSLIHDTKEDTDNAYNMIAQ
FT                   GALRKNIGEFGDKGARDFPSVNLFLASHNKESVVTAHELHKNRVMSGLPTVPVRFAQLH
FT                   GMSDEVSFSLLQMNDGDGTPEVYKCSTWGGMGECLAYLLRRAIENRDAVLRTDNEYRAL
FT                   KKEVFRRVKSVLSLSPSS"
FT   CDS_pept        join(313975..314170,314228..314410,314472..315646)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824605"
FT                   /orf_name="Pc13g01350"
FT                   /product="Pc13g01350 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91204.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018305D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0"
FT                   /transl_table=1
FT                   /translation="MAPKLKGKSLSLIIGLVGAVGFVLQGYDQAVANGLLTLGSFIAVF
FT                   PQIDTVHTSGSEKSHNSTIQGTTVAIYEVGCALGAGSCAFLGDRLGRRKTIFLAGCVAL
FT                   VGVAIQASPFSLGQLIAGRVITGLGVGGFTATIPMYVSESSGAEARGRMVLLEGWFAIG
FT                   GIVLATWLEFGLYYVSDNSASWRFPIAFQGLFALVVVGCIMLLPESPRWLARVGRLEEA
FT                   SEVLARMENAPVDSEHVLQELEIIRQSLVIDDSTELAGSSSPFALTKNRHLHRTVIAVG
FT                   VNILAQMTGVNIITFYSDTIFESNLGYSGTLSRIITGCLQIWQFLAAGVAGLLIDRVGR
FT                   RPLLIAAAAGMTLAQACLAGLSSHLENRSAAGASLLFYFVALFCFPIGLFLVPFMYAAE
FT                   IAPLRTRAKVTAMAAAANWLFNFVLAEVSPVGFATIHWRYYIVYACISAFACVSFYFFC
FT                   PETKGRTLEEIDDIFVQSKSAFDTVRIAREMPYQTEILAHVSDTEKGGLEAMQVENASK
FT                   "
FT   sig_peptide     313975..314049
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0 "
FT   mat_peptide     join(314050..314170,314228..314410,314472..315643)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0 "
FT   CDS_pept        join(complement(316872..316996),complement(316096..316819))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948746"
FT                   /orf_name="Pc13g01360"
FT                   /product="Pc13g01360 protein"
FT                   /protein_id="CAP91205.1"
FT                   /db_xref="UniParc:UPI00018305D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q1"
FT                   /transl_table=1
FT                   /translation="MQHQIQNEARWSNPQLGQLAGDLAAAAASASLVTPAVAIIDRALV
FT                   EQAAFKQPIFCGLRRHALGALRQPGLFVFQRPFGIVWALYAATYSVANVTDTISRKLEI
FT                   TAAGAITFATTMLANVPLALWKDLRFAQEYGTGRGPDAKTSKATTPIPVPLQNKSLART
FT                   AAAIFLVRDGFTIFGSFTLAPWLSDAIPDSLAAHPQAKPIITQLTVPVLTQLVATPLHL
FT                   LALDMYTRQYTMPFLERVKHSQQYLPSSTLLRCVRIIPAFGIGCLTNMELRSAFHAKAS
FT                   G"
FT   CDS_pept        join(317309..317449,317500..317972,318029..318978,
FT                   319037..319209)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671903"
FT                   /orf_name="Pc13g01370"
FT                   /product="Pc13g01370 protein"
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAP91206.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00018305D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q2"
FT                   /transl_table=1
FT                   /translation="MSTTLMRLRSARPTGSRLRSVPAGLSIQARAKATMPFRLPDGRNE
FT                   PNPLYKKGSPERAKVEEALTKLRSQLPVRSELFYDGKLQASSKSWDQPLPAEHATTFTN
FT                   YPFATDEQVRSAIELALEAKQSWQDTPFVDRASIFLKAAELVCTKYRYEIIAATMLGQG
FT                   KNIWQGEIDAAAELADFFRLNCNWAAEILEKQPTRGSDGMWSRIDYRPLEGFVYAVSPF
FT                   NFTAIGGNLICGPALMGNVVVWKPSASNVYASSLLYKILLEAGLPPNVIQFVTGDPEAI
FT                   TETVLSHRDFAGLNFIGSSDVFRSLYGKIGQGVAAKKYREFPRFVAETSGKNFHLVHPS
FT                   ADITSAVNHTIRGSFEYQGQKCSATSRLYLPESRAEEFLTQLKAGIKEITIGNPDKDLS
FT                   AFMGPVIHRGSFEKIKSVIDASNKDPSLKLIAGGTYDGSVGYYVHPTVYQADSPDHRLF
FT                   NEEIFGPVLAVHIYKDADWASTLKSVDQNGGGFALTGAVFAKDRIAIRQAEDALRYSAG
FT                   NFYINCKTTAALIGQQSFGGARASGTNDKAGSSDPLRRFVSPRLIKEEFFGQEGFTYPS
FT                   ND"
FT   CDS_pept        join(319798..320029,320083..321173)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948747"
FT                   /orf_name="Pc13g01380"
FT                   /product="Pc13g01380 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91207.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00018305D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q3"
FT                   /transl_table=1
FT                   /translation="MAIPKSEPIIIVGGGAFGLSSALHLTRSGFTNISVFERDEHIPPR
FT                   YSAANDLNKIVRAEYEDPFYTDLTIVSQPSMYTIAAWKTPLFAPHFHQTGFLHCVSGEA
FT                   PQKAIDTLNRFRASANGNDQLKSHVVPLRGEDDIRQACWQLDGPLSGWNGYLNRFDGYA
FT                   HSGNALAGVYRAAQAAGVRFYLGERGAVDEIVYVSTLQGEKSSGIRTKDGKFHPSSLVI
FT                   VAAGGAVSRLVPEIGKKVVAKSWSVAHVHLTDEETSALRGIPVTYARDLGFLFEPDPQT
FT                   NLLKICPMGGGYVNTDPVTGVSHAPRSLEESAFVPEHDERQMRKLLAQTLPALANRPLV
FT                   KKSLCWFADTDDSDFIIDFVPGTSSSVVLLSGDSGHGFKMFPIFGSWVSDFLQAGQQRE
FT                   ARWKWKHAGPNESKGNWGGDVSWRLGVSKELSEIRPVLSKL"
FT   sig_peptide     319798..319863
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q3 "
FT   mat_peptide     join(319864..320029,320083..321170)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q3 "
FT   CDS_pept        join(complement(323629..323840),complement(323481..323578),
FT                   complement(323273..323428),complement(322688..323226),
FT                   complement(322367..322637),complement(322141..322313),
FT                   complement(321895..322078),complement(321349..321842))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948748"
FT                   /orf_name="Pc13g01390"
FT                   /product="Pc13g01390 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91208.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018305D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q4"
FT                   /transl_table=1
FT                   /translation="MHTNNLVVHDAGDKRSNVPGHSHAMDAASERLVKMLHVSCLSLIS
FT                   SAYPGLSAKLSCIFDDRDQKILVTKGYIMELQQKIARIEQKEKGQASPFSSNFDTQTID
FT                   PKDRERVPTLERTSTPDDHNEPRELDDLDSELANPLSSGPPAFMSAANGRTFYLGTSSN
FT                   WSFTRRVLSLAHQHLYQDVLPTESLIFDETTYELGWDGLRTTPSLDFPVVPTRDHTMYL
FT                   INAVKFRCGQLYHLFEEDVFMSSLQQFYSGDGQSMTNSLWYIHFLLILAFGKGFVQPKA
FT                   QGRKPPGVSYFVKALQLLPDPTALYRDPTLGTEILCCIALYYQCVDFRTSAHNYIGQAM
FT                   RIAMAQGMHTSMPVEALGHDMVQRSGKIWWTIYILDREMTSLMGLPQSINDRYVQTQLP
FT                   TFADPSETMSLGMHIKLSQIIAEVNSTIYVINGRINRTFLLSTKTALANIAGLADELRE
FT                   SFPLYLDPGSGISRISAYLHLQYHQCIILATRPLLFCFLKIRFESPESCLESLNASRNV
FT                   RNLMQMCLESAQNIISILSSLQGQGLLETFLPFDLESVFVSTIILLMGPAIDPRVLESH
FT                   PNWLEKAYAIFDEMIRDGNQVAKFRRSELQQLHETLLGCISGDQPRQLAVPDFFQQADV
FT                   LPNPASPSVTPIPGAMPQSIRYDDALLRPDTDLDAECDFSTMLTSAEIMAVADSIESYD
FT                   TEWVSNAMVEHSIW"
FT   CDS_pept        join(complement(325024..325753),complement(324242..324906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948749"
FT                   /orf_name="Pc13g01400"
FT                   /product="Pc13g01400 protein"
FT                   /protein_id="CAP91209.1"
FT                   /db_xref="UniParc:UPI00018305D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q5"
FT                   /transl_table=1
FT                   /translation="MSADLLAEFGQAPAPDNKSGQQPSQYQKNSFFGVDDNVDFFGSSG
FT                   SAQHNKPTHPNPGAVGQFATPAASCQRPSHQGFDLPLNPHSDVLFDAAFDTPASDDDWG
FT                   EFEGPDSNTQHEHSTALQHSMTATSQKPESWQDDPQGIKTIDLLDSLSVQDPVPVVKHP
FT                   SQIAKKEQQLEPTNSRAEPTWDDDSFDDWGDFADAPASQPLPKVSEKKTKPPTKPPTKP
FT                   LVKSNKPPASTWDDDAFDDWGAPAATVRPTNIPPPSVLLELFLDVFENLHKEAALAKSQ
FT                   LRSSAPPSSSSSNTVSTTALNIHNVLQSAARVIAGRSLRWKRDTILSQSMRIGPARSGK
FT                   AGGMKLNSVNKQENIKEEQDAVDVITTWRERAAVFNAVLQAAGLRPIPTVPDASALKVI
FT                   TARADQGALKASHPCALCSLKRDERVLRVDEQNVQDSFGEWWTEHWGHTACRQFWERNR
FT                   NLLGQR"
FT   CDS_pept        join(complement(328554..328657),complement(328039..328112),
FT                   complement(326589..327973))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948750"
FT                   /orf_name="Pc13g01410"
FT                   /product="Putative uncharacterized protein Pc13g01410 "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91210.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00018305D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q6"
FT                   /transl_table=1
FT                   /translation="MDLVGLYRKDGITPTTLPNFADLHPKSGTKDLLVIPSEDGWFVSD
FT                   FYLFHYLLSPKFPRPPNQIWLTCEDPSALVRKYHEYLHGNPKGDRRAVLDGERLPNILG
FT                   AGNVRVVPRIDLLERYLSTLREQAAEATRCEEHLVLLFFGHGTPAHGIEVGDSILHMKD
FT                   LRHLLQPMSSTTIFTTSCYSGGWLVCPDINQEQLNTTSITASGKDNESSSWTVSGSAGR
FT                   ASGSLAASAVLRCLIDAEDETQERTEHPTYLELSKSVYDCVKDMVTLGNSQQIYFSAEN
FT                   DEWETSYQPRLGLPLASYKDKWLSLRQVPPSPSPPSSTSSPELAKTGGRRLKRLKYLAE
FT                   EYFAAKPGPNEASPNIGLHNCLRSVLNGATYPKEKVDSLTETTTYRLGAMYEADYLREQ
FT                   IGLKFPSIFSMETPLAQIENESCNPELYTQTWSLLLKRKICTTPIGIRLHFPKPLQYLT
FT                   IALVESSTSWEMIQDQVEAMASKKKAWFRFIYRAWMGNRVAHDEGVMNSRRAFLEACKK
FT                   LKY"
FT   CDS_pept        join(329148..329170,329222..329339,329395..329553,
FT                   329619..330136,330191..331613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948751"
FT                   /orf_name="Pc13g01420"
FT                   /product="Pc13g01420 protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91211.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00018305D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q7"
FT                   /transl_table=1
FT                   /translation="MRTIEETRKRWDILFSDNDTPSDLRAALQSEHGGNLCNDGLRSVC
FT                   WKAFLLFDGLDKSEWAPKLDESRDAYRALRDHFLKYIEHPDDLESTVDPLADDEQSPWQ
FT                   TLRHDETLRAEILQDVDRCLQENFFFQEPDTKSKLTDILFVYSKLNPDVGYRQGMHELL
FT                   APILWAVDRDSVKPNLEDLDANKDKSEGLMRKLLDAQFVEHDAFTLFLSVMQTARIYYE
FT                   HGETRSANGQMDVIPIVDRCHYLHKEALTIIDHELAEHLEAVDVLPQIFLTRWMRLLFG
FT                   REVPFDDVLTMWDLLFAHGLRSDLVDFTCIAMLLRIRWQCWSACSIFHRIFIADMHHLV
FT                   LTADYTTALTLLLRYPSPQPHTTQSFVHDALYLEQNPTADRGSFIISKYSGRPPDAKFR
FT                   QQPSTRPTRKAFLWEDFKKRSGSNSPTGSPARNSPNSLESLFQDVSQGIQRRTETWGVA
FT                   KAVRGAVTEARKNMQTMNFDPNMRPVSSRPISAASASDIQSKAPMASTVASARLETKIN
FT                   LLEKRNQALATMLREALDDLGSQLANIKDLGSDTNSAVKQALVKAESVQVCLGDSSIPV
FT                   DPPLDPRVDGELNQLDELQETVTSTMGKEDDNVVANEGQSRTINPVKADTTGPKAESGT
FT                   NPTLDTASRTNSDRKESARAIRSRPTVRPSMTDSGFSWMLGGGRNLSGFVSSTSPPPEQ
FT                   TRHLDQTRGKPKPNALFGLSGDDNLGPDSEHSELALYSLRGSRDPLSGTGPL"
FT   CDS_pept        join(332793..333062,333092..333261,333323..336288,
FT                   336367..336617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128950"
FT                   /orf_name="Pc13g01430"
FT                   /product="Pc13g01430 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91212.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018305DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q8"
FT                   /transl_table=1
FT                   /translation="MGLGELVEVRSKEPGHHLTRIELTTHRALRKEGLGEQPGRESIFS
FT                   QAITATRQHMPGYASDRRDQLLDHLEASHFLGRPVKWKPRDAPIEVNLADQNLGEPSPL
FT                   SSPLGPLSESPESESGLHHLSLQTDRLRSSAGSVSSGYDPLSRSPLFENDHGIGPSGLD
FT                   RIRHNQPSRVLTLPNMSTSSLSLGPIPSQRPVPSPRSRSSSRAHTGHLSNRSFTDLEDL
FT                   HRFPLESLHSFSFAQQSEEFLHSRQNILKRSIDFMRDRMGWAASNAAIANAQANASGDT
FT                   EMQGMMELLARANMLETQENQIQGRGPITGPAEINGDNIFEKAFSDADSSPVSTRGGVQ
FT                   DSIPSGSHPSDGSQLLSPVPSDSISNQRRDLVSAPTSRRVSLKRTYTDLCSVSVRSKLM
FT                   ETLAQPYTSSADPFASLNSSTAGLGFQIPAPHAHSNKWTPASQAVFRTEAKEPWTILAA
FT                   NDLSCLIFGVLQSEVRRLSILEVVQKEHREWLKAKLRDPSTDAAARMPLQPERANISAV
FT                   NPKFRGLGNGVTAQLLSKPSSREKSRRAQTDDGYGSSTRNTRNNNHPANKSRGVLLCGD
FT                   VVPIQKRNGSRGSASVWVMEKRGGLIWVLEEITENVASIQCDDSWNVVSAKGAVEKIWG
FT                   PSVVQKGQSITDLLPCLPSDSLETSLEKGLAKIVELKHFAARTAAGVCIPVAVGKGEGD
FT                   RTLQVSSFPHVAGMMVLSSSSLNVISSNSVFSSVLFGQQRPEGLHITQLVPDFDEILDV
FT                   LTEEDNVPLVDGIVIPEHSFRRARTLSILRDGKANAASVFTEPSGLLAKHRDGSTIVVD
FT                   IQLRVVKSGTLFSKDKAEKSSDRSSDSDDSDDTIAVTELVYALWITYSRQLHAAGPAAG
FT                   LSPSSVPSSKPTSPTHDPDSVRPSDASAATQTADNSKAYVEIQTPTSTLSQQLSEAASE
FT                   PLAARPAQPVPPVSAANAKNDPPAKRTINDYVILEEMGQGAYGQVKLARLKKQPNKKMV
FT                   LKFVTKKRILVDTWTRDRRLGTVPLEIHVLDFLRRDGLKHPNIVEMEGFFEDDINYYIE
FT                   MTPHGLPGMDLFDYIELKANMDESECQNIFKQVASAVNHLHTKALVVHRDIKDENVVLD
FT                   GEGRIKLIDFGSAAYIKNGPFDVFVGTIVLQGRSYRGKEQDIWALGILLYTIVYKENPF
FT                   YNVDEILDHPLRIPFLPFSEDCIDLIRTMLDRDVDNRLTITEVLEHPWMVGA"
FT   CDS_pept        join(complement(337523..337609),complement(337310..337431),
FT                   complement(337055..337160))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948752"
FT                   /orf_name="Pc13g01440"
FT                   /product="Putative uncharacterized protein Pc13g01440 "
FT                   /protein_id="CAP91213.1"
FT                   /db_xref="UniParc:UPI00018305DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9"
FT                   /transl_table=1
FT                   /translation="MPFSWYFLSASWVTLEYIVQYTLVSVYETNPLKAPIQGHPRGQVP
FT                   ERQVRFIFASFGLPRCPGVFAGGGIIPNCIELERSGEAQLLNLAYKVELGPIVMQTKPH
FT                   "
FT   mat_peptide     join(complement(337523..337564),complement(337310..337431),
FT                   complement(337058..337160))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9 "
FT   sig_peptide     complement(337565..337609)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9 "
FT   CDS_pept        338243..340456
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948753"
FT                   /orf_name="Pc13g01450"
FT                   /product="Pc13g01450 protein"
FT                   /protein_id="CAP91214.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00018306A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R0"
FT                   /transl_table=1
FT                   /translation="MASQVSDDILPSPGNISPNSPTNSAGQIPLEQPPKLKGRQKLLQS
FT                   LQRMSSSPTLTRRGRSSSTTSYRRDNKASLSCVSLSSTSYSPCLGNGSSSHLYGGLNPR
FT                   PATPGCSSSPYEPQGTNARIRLMDTDGPGFTTPRTVPLPFDVRPASRGSPRTATPVGVK
FT                   VEKEVITPESQPARSLDFWGDMPQELKIEIFQYLTPQEIVCCSSVSKTWNEMCYDGQLW
FT                   SKVDTTEYYSKIPSDVLVKLITSGGPFVRDLNLRGCVQMREKWSTDGERISDLCRNVVK
FT                   FSLEGCRIDKASIYSFLLRNSRLEYINLSGLTSVTNSAMKVIARSCPQLETLNVSWCNH
FT                   VDTTGLLRIVRSCERLKDLRASEIRGFEDEKFTLALFERNTLDRLIMSRTDLTDSSLKM
FT                   LMHGDNPSMDILTDRPIVPPRKFRHLDLHHCPDVSDDGLKSLAHNVPDLEGLQISQCSD
FT                   LTDESVMNVISTTPKLSHLELEDLENLTNITLVQLAESPCAQNLEHLNISYCESLSDTG
FT                   MLRVMKNCPKLRSVEMDNTRVSDLTLMEASFRIRRRGYSDELPKVGLRLMIFDCANVTW
FT                   AGVREVLSSNAYIPRASRKPVSTVVTVTQTSDAGSSPETSTFVTPASSPSPSPAPTYPN
FT                   EVIQLKCFYGWQMTVDEHTKRVLRGDLTAASRLDRKWAEYMIATEEAGAAGAGARRRRR
FT                   RAREAERLYNEDEDENDGYGVGSISALGGRRRRAQSGSSCIVM"
FT   CDS_pept        join(complement(344712..345261),complement(343659..344660),
FT                   complement(343512..343604),complement(342185..343461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977832"
FT                   /orf_name="Pc13g01460"
FT                   /product="Pc13g01460 protein"
FT                   /protein_id="CAP91215.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018306A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R1"
FT                   /transl_table=1
FT                   /translation="MESAIRWSPTSSATEQRFLSVDVTGKSFRLCKVTGFDGNYIRHEV
FT                   LSTLSNVPGFRAFDWSTSNENLIAVGQSSGEATILRLDGDAKESLSFPVRNQRYCNAVA
FT                   FSTHGLVASGLDRVRNDFCLNIWDVNQRLSPAGGSRGFTEPLRKLASSEPITSIKFFRD
FT                   QPDTIVTGVKGQFVRIYDLREGPGNPSLQFPTRCVHNLAIDWLDENYIASCIPSNESTI
FT                   CVWDRRVGSRLTSPSMGSSASVADSGQATPALELKNVFHPKSSIWSLRFSRTNRGSLAA
FT                   LSSNGHFKNYDIAKDYLPEEYRSSIDETLGQGSSRNYPESVYTKHVRDVCVPFDNPTRS
FT                   YKEKDRVVCFDSLNLSLSPQPSAIALDGNGQPQIITARPPCAPVDLSSRSVLACGISSS
FT                   DSDVRSIHPLSEHISPISDLIGNIRSRVCSTSQEHGANSNGQLFVSKNLGFEPVPSHEN
FT                   RERVMALGVMGVPLTAKEALTLCTINQSRCKEGYLFDEARNRKVASDDQALQDFWGWVE
FT                   RARVGSSGTSMVVNGLDLNYLGVNSVWNNDLGKGFEQRCISAKKDDAKTVADAVATLAT
FT                   QLNLPETKGCDTAYPDHRRLCLRLCGATQSYRELEESVKNLSSEDQHTKAAALAVFQDE
FT                   PKLAYLGLRSNNPTQAHKLLAMAIAGASKGDNGTDWEDTCAEIAKELTDPYARAILALV
FT                   SKGDWNAVIKETTLPLKYRVEVALRWLPDDELTEYLKDATSQAIRQGDIEGVVLTGLGH
FT                   LAMGLFQSYIGKFNDVQTPVLAMSHTVPRFISNEKHIVQFEAWRETYRRQMNSWKLQLE
FT                   RARFDVGSRRFAVTADGRKLMPPPPQQVSLTCNYCTSPLTQHDASSQISPSTKSAEHVH
FT                   PTTGNPLAPTVMSGTVCPRCGRHMPRCGVCTLWLGSPDPMSRASIAADAEAGSREPTET
FT                   EVMRRFVVFCIHCNHGFHANHASDWFKRHKICPVAECNCICDR"
FT   CDS_pept        join(345529..345943,346009..346589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977833"
FT                   /orf_name="Pc13g01470"
FT                   /product="Pc13g01470 protein"
FT                   /protein_id="CAP91216.1"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI00018306A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R2"
FT                   /transl_table=1
FT                   /translation="MSTDTRNQIDQSAPSKRKTRDGSEEVPPARKKVHRKANKADDQAQ
FT                   FVDFSKGDAAKPKVTRQFKDKFAPKPEKEYPSINDLKKRIRDVKRLLNKVDLPADARIL
FT                   QERALAGYEQDLADETARRERSSLIKKYHFVRFLDRKTATKELNRLTRREKEDLDSKQK
FT                   ARLAAKIHNCRVNLNYTIYYPLTEKYIALYPNGKHDTTDPESELQKQETKSNDAKPPLW
FT                   SVVEKCMEEKTLDLLREGKLYINANGEKIQSSSSGATTAANSQKEQSKKKEQKKETKAA
FT                   TQKDKYVSKDDKKSSKKEKTARNEKASKQHEASQQPNAEDEDDSDGGFFE"
FT   CDS_pept        complement(347926..349626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948754"
FT                   /orf_name="Pc13g01480"
FT                   /product="Putative uncharacterized protein Pc13g01480 "
FT                   /protein_id="CAP91217.1"
FT                   /db_xref="UniParc:UPI00018306A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R3"
FT                   /transl_table=1
FT                   /translation="MACTVSGETAFIKQQEILRDRCSKALADHLKENPDVVWTPKDGRG
FT                   ERPSSSEEAAKLKLVVDVEFDEETGQPDFPPGNNRLSDELVYLVTKFMNARDLGRRYPY
FT                   DFDKMGNINPQRVPSGPAPIIWAHGLPFFPVYKGYYILCGRAHAGCIGWLLHEKTGEIM
FT                   QANPIWSVGAVVAPDSAVKAPRNITRQMTQHKPSGSEKNPGYRGKAWARDVVAAEHHLC
FT                   AVFPNLDSDEIEVCPMWNSWGYNVRCGPMRSGVKPTTMPKDFFTSHGIKNIDYESLARP
FT                   YGNHLMDEDEDSDDKDDPDGDVEVIDRAGESVEDASGSNQPIMTQSASQMDVDMNLVSL
FT                   LEVTKQVPAQSPGQHQEQVPEEQDAVRAPVQSPAAAAEKIKEGVKENVKEEAKEEVNEE
FT                   AMEKAIEVPVKQVTEETAKDSEIAPSDLEEKQLAVSNSTVDTELAMMTNIGDSIEQSNE
FT                   NPAPEQTSTAPVLLAETTIQATAIVQPIEVQPKIKQSEIEHAVTGTSDDNTHTIEPLKV
FT                   EQIAPDQPGTEQLDQTAASVLPEDLKVAGVPASNKTDASRSQAPAEVPM"
FT   CDS_pept        join(351510..351668,351725..352594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824606"
FT                   /orf_name="Pc13g01490"
FT                   /product="Pc13g01490 protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="CAP91218.1"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI00018306AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R4"
FT                   /transl_table=1
FT                   /translation="MDHPKNNKDKRGRGQGQSRDVQVSKALSLLLRHAAEKEGLKMNTQ
FT                   GYASVSDVLNWRKLKSLKVTFPEILHAVDSSDKKRFALLHIPSAQPTKSTTQATTTPAT
FT                   SPDAEHEAGSIVGEEQPATSVLESAPTTSEAQQSATDQALSVKDTDPSNFLIRATQGHS
FT                   IKTVDAASFLEPLSLSDESKLPDTVVHGTFHATWPAILQSGGLRCMGRNHVHFATGPSL
FT                   ESVLAVNAEDAARSKPKPDDSRVISGMRRDAQVLIYIDVRKALKAGVPFWRSENGVILS
FT                   EGIPVTKGEAEKGEAQKFVTLDFFDVVVERKVGLGKIWEHGEVLQGLPETLTNKGNPKG
FT                   RR"
FT   CDS_pept        join(353298..353545,353612..354044,354099..354299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948755"
FT                   /orf_name="Pc13g01500"
FT                   /product="Pc13g01500 protein"
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91219.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI00018306AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R5"
FT                   /transl_table=1
FT                   /translation="MATHRFDPTFTDNVINAMGPKTTPRVRKLMAGLIRHMHDYAREEE
FT                   LTVDEWMAGVQMLNWAGQMSDDKRNEGQLVCDVLGLESLVDEITFTLAGEAQDAPTATA
FT                   ILGPFFRADTPYRENGEDIVKTKPADAEMAFMHGRVMDFQTKQPLVGATVEVWQASTNG
FT                   LYEQQDPEQVEFNLRGKFKTDEDGRYSFYCLRPTPYPVPNDGPGGKLLELMDRHPFRPA
FT                   HIHIIATYDNYRPLTTQIFDRKDKYLDNDSVFAVKDSLVVDFVPRKDDPKAAIELEYDV
FT                   KLVKFEASTGGA"
FT   CDS_pept        join(complement(354910..355345),complement(354440..354816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671904"
FT                   /orf_name="Pc13g01510"
FT                   /product="Pc13g01510 protein"
FT                   /protein_id="CAP91220.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00018306AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R6"
FT                   /transl_table=1
FT                   /translation="MPFVQANSHRLNYADSHPDGPPTPNSLTFFFIHGLGSSQNYYYPV
FT                   IPHLTKLHRCITLDTYGSARSPYTDETVTLPGIAEDVIGVMDTLHIQKAVVVGHSMGGI
FT                   VVTELGARCPERIQGVVAIGPTHPSDTLVTVMNKRSETVLESGIEPMANTIPFGAVGSR
FT                   STPLQKAFIRELILGQDPKGYAALCRAIATAKPADYAAVKAPFLLIAGDEDKSASMEGC
FT                   QHIFHHISSEQKSLEVLKRVGHWHCIEAADEVGGLIAKFGDVLKAVNA"
FT   CDS_pept        complement(355779..356756)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948756"
FT                   /orf_name="Pc13g01520"
FT                   /product="Pc13g01520 protein"
FT                   /protein_id="CAP91221.1"
FT                   /db_xref="UniParc:UPI00018306AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R7"
FT                   /transl_table=1
FT                   /translation="MPDEPRRIILEKSKTVKRRYQRSNQRFQFTASQIARLDREEEREK
FT                   KAKKLREKEKKRIANKKRKAEQEAQAREERKRRGIPDPNAARVPSSQPLLSMFLGAGKR
FT                   QSPAAPEPAPTVTELESHDNNLESASGDTEAESDAFDDLDEVLENDLSEIQDSGVRKEL
FT                   QGQEIGTATRAPCKEDDEFSDCSAFDDEEIIKKAETAATTRTTDEETKKPSIPKESSYL
FT                   QSPPAVLALESSFGGSFQYDPADFLEAEAAIITQMSPPGMKDRSPPKDISLLQPPLSDR
FT                   PYSRPTLASSFGDSFRDETADWIEETFAHGNGDPFDELHKTLSQ"
FT   CDS_pept        join(complement(358072..358143),complement(358001..358011),
FT                   complement(357884..357941),complement(357644..357825),
FT                   complement(357058..357583))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128951"
FT                   /orf_name="Pc13g01530"
FT                   /product="Pc13g01530 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91222.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00018306AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R8"
FT                   /transl_table=1
FT                   /translation="MAPISLQSTYKLVSGYEIPVVGFGVYQTPSDVTEKVTRKAIELGY
FT                   RHVDSAKVYGNEKESAAAIRGSGLDRSKIFYTSKVPSKCMGYEKAKKAIEESIAAANLG
FT                   YIDLMLIHAPYGGKEDRLGTWRALVEAQKAGHVRSLGVSNFAIQHLEELEEYIKSGAGG
FT                   QITVGQYEIHPWCPREDIAEWLRKREIIVEAYSPLVQATRMKEPVLQNLAKKHGKTEAQ
FT                   ILVRWSLQKGYVPLPKSVTESRILENSQVFDFTLSDEDMASLQLNTYEPVCWDPVRDCK
FT                   I"
FT   CDS_pept        join(358980..359057,359124..359612,359680..360324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948757"
FT                   /orf_name="Pc13g01540"
FT                   /product="Pc13g01540 protein"
FT                   /biological_process="translation"
FT                   /protein_id="CAP91223.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI00018306AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P1"
FT                   /transl_table=1
FT                   /translation="MRCIKNKIEHNGSGAVTLCPEEPEDMWHAYNLIRPDDILRASAIR
FT                   RVTTVQDTGSTSSARVHLNLVIRVKNLDFDPQSSQLHVSGQIINETPHTKIGQFHTLDL
FT                   ELNRNFTLEKEIGAGGEGVGWDSIAIESLKDAVDEGGKRRAEAVAVVMQEGLAHICFIG
FT                   QFQTILKQKIEMSVPRKRQGGGDHDKGMNKFFKVTLETLIRQMEFNTSLTSGANNEAVR
FT                   PVLLASPGFVASGFQKYIQSEASTTTPGLKRLLPSLVVVHSASGYTNSLSEVLQSPAVK
FT                   RLLADTKYARETKLMDDFLEQLRKETNKATYGPREVEDAVEQGAVGRGGGVLIVSNRLF
FT                   RSQDVAERKRWVALVDRVRDVEGGDVRILSSDHESGKRLEGLGGIAALLTFPVIEPDLD
FT                   SDAE"
FT   CDS_pept        join(complement(362106..362344),complement(361079..362027))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977834"
FT                   /orf_name="Pc13g01550"
FT                   /product="Pc13g01550 protein"
FT                   /protein_id="CAP91224.1"
FT                   /db_xref="UniParc:UPI00018306B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P2"
FT                   /transl_table=1
FT                   /translation="MSIILEDNQPPGFLRLGPTWYHEIPFLPHGWETTNDRGCGSLKHA
FT                   AMKAMLRDQSALKPELFEYVHWYMAEYLWDALKRCNKQTMHMWKIMASVYPVQFYKVSP
FT                   YYCLSAGCPKKPLRDYMGILNSEDFRWRAILTIATTYCTATDLTTIPNIKNLVALDVHN
FT                   EPYTSNNAPLHPVGVNNDGLLLQDGFVRGWIESKALRHLRILRFYHQHEMTVASLAALR
FT                   ELPELQLVVAYECKKITETIQKYDKPANGVIPVKGWSACRLDWFWENHGTSKTIDDNLL
FT                   ALHHVYQSSLQTPGEDSRRPSSLPTNLPILEFKLPTVDHSKRDRVVVRSRYNAKSIVLF
FT                   TRDPVKQKLDIKKQQRAREKKKRTEPPEKGDHPAKRAVMKERGPMDISETLNQFF"
FT   CDS_pept        join(complement(365274..365901),complement(363998..365220))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128952"
FT                   /orf_name="Pc13g01560"
FT                   /product="Pc13g01560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91225.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018306B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P3"
FT                   /transl_table=1
FT                   /translation="MQSFLQHRVLRRKLEQQFVTKHEKPENVWTHEGQYGYREGEIYTH
FT                   PRERSDDLAAERRREHGRRTFISGPSLQPRHSAASHLGREGDIEGAEYDPDLSTDPHTI
FT                   NSAETLGNTPDIMVTGVERPRPGFSTDSESDIESVKRNKLVVVTFEGEDDEMDPHNWTL
FT                   RRRMLVTLLTALMGCVIFWSSTIDTTALPKTRKVYHTSFEVQTLPTAMFLIGCGVGALI
FT                   TAPISEVIGRNPVYIPTMIGFMLFNTGAGLAQTIVQRVVCRGLAGFFGSAPAVLSAATL
FT                   VDVWSRIERVYAFPIYSIIIFIGPIVGPTPGSFAVDAESVSWRWVDWMTIIFAGLVLIP
FT                   VVLFLPESYSPILLYWKAQELRRLTGDDRYRSPLEFRKATFAHRLRASLYRPLLLFATE
FT                   PIILIHSVYLTVLFMILYTFLAGYVSIYHMASHFSPTSTALAFLGILVGVLLSLLILPI
FT                   SMWLLRREIYRSRRRGEHRPDPEISLYMAMFGAPAVPISLFWMGWTAELEFSYWSPLVA
FT                   SVFYGFGTVCIFVSGYQYVSDAFESHATSALSSLQMTRLVGAGAMVIVAEIMYTNLGVG
FT                   WTLTLWGCLSALFTPVPYLLYWRGYNLRQRSWYARRHEHD"
FT   CDS_pept        join(366808..366824,366932..366944,367071..367200,
FT                   367273..367429,367492..367654)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824607"
FT                   /orf_name="Pc13g01570"
FT                   /product="Pc13g01570 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAP91226.1"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI00018306B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P4"
FT                   /transl_table=1
FT                   /translation="MVSELCPVYAPFIGSMGCVCAIVFTCFGAAYGTAKAGVGVCSTAV
FT                   LRPDLVVKNIVPVVMAGIIGIYGLVVSVLVANDLKQNIPLYTGLVQLCTGLSVGLAGLA
FT                   SGFAIGVVGDAGVRGTAQQPRLYVGMILILIFAEVLGKNEIITAGLTQNEKLIRA"
FT   CDS_pept        join(complement(369630..369949),complement(369101..369510),
FT                   complement(368410..369047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948758"
FT                   /orf_name="Pc13g01580"
FT                   /product="Pc13g01580 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91227.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00018306B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T6"
FT                   /transl_table=1
FT                   /translation="VMETRKTKLGEDHPDTLTSMANLASTYRNQGRWEEAEQLFVXVIE
FT                   TRKTKLGEDHPDTLTSMANLASTYRNXGRWEEAEQLFIXVIETRKTKLSEDHPDTLTSI
FT                   ANLASTYRNXGRWEEAEQLEVXVIETRKTKLGEDHPDTLTSMANLASTFIRASGKRPNS
FT                   SRCRLETRKTKLGEDHPDTLTSMANLASTYRNQGRWKEAEQLEVXVIETCKTKLGEDYP
FT                   DTLTSMANLVVTFSNQGRWEEAEXLEVQVMETSKIKLGEDHPDTLTSMANLAVTFSNRG
FT                   RWEEAEQLFVXVIETSKTKLGEDHPDTLTSMANLAVTYSNQGREXEAEQLFVXVIETRK
FT                   TKLGEDHPDTLTSMANLASTFYNQGRWEEAEXLNVQVMETRKTKLGEDHPDTLTSMANL
FT                   AFTWKSSGHDAEARSLLRECLTKQKQTLGLNHHTTLSNSETLLAWETEGEWQTDEESGS
FT                   DTEY"
FT   CDS_pept        join(complement(373055..373100),complement(372806..372972),
FT                   complement(372397..372733),complement(371963..372335),
FT                   complement(371242..371903),complement(371064..371167))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948759"
FT                   /orf_name="Pc13g01590"
FT                   /product="Pc13g01590 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91228.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000183076F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R9"
FT                   /transl_table=1
FT                   /translation="MAFNGQTPTIVVLKEGTDASQGKGQIISNINACVAVQGTVKSTLG
FT                   PYGGDLLLVDANGRQTITNDGATVMKLLDIVHPAARILTDIARSQDAEVGDGTTSVVVL
FT                   AGEILKEVRDLVEQGVSSQTIIKGLRRASAMAVNKVKEIAVDMMDASVSQEKKVETLRR
FT                   LAATAMNSKLIKRNSDFFTKMVVDAVLSLDQDDLNERLIGVKKVTGGGLQDSLFVDGVA
FT                   FKKTFSYAGFEQQPKHFENPSIVCLNVELELKSEKDNAEVRVEQVSEYQAIVDAEWQII
FT                   FNKLEAIYKTGAKVVLSKLPIGDLATQYFADRDIFCAGRVASDDMDRVCQATGAATQST
FT                   CTDIQARHLGTCGAFEERQIGGERFNLFSDCPRAKTCTLVLRGGAEQFIAEVERSLHDA
FT                   IMIVKRALRNTTIVAGGGATEMELSSYMHGFADRNVPHKQQAVVKAFAKALEVIPRQLC
FT                   DNAGFDATDILNRLRVEHRKGNTWAGVDFDKEGVRDNMVAFVWEPSLVKVNAIQAAVEA
FT                   SCLILSVDETIKNEESAQPGQQRGMPPGAAQRALRGRGRGMPRRG"
FT   CDS_pept        join(complement(374664..375161),complement(373552..374610))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948760"
FT                   /orf_name="Pc13g01600"
FT                   /product="Pc13g01600 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP91229.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015416"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001830770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S0"
FT                   /transl_table=1
FT                   /translation="MSEVHGDSELVPSGPDLDYPLALAPRQVTLRDRVTVATLVPFASA
FT                   EEVPRALMKYLSDQFNKEIEKGDTYAMTEPIPLAQFGRYWFSNFGVVMLTGDIESAEQT
FT                   HAMDRAGANWTKICLGGFHIRPNYPGRSSHVCNGTFIVTDAARNKGVGRLMGESYLEWA
FT                   PRLGYTYAVFNLVYESNVASCRLWDSLGFKRIGRVPGGGSIKSQPGEFVDAIIYGRGLS
FT                   LDGEDSVSQDRFEKIRYYLKHGKYPRGADRAEKSRLRSAATHYKLLGGEDGEPERLMLK
FT                   DKEVVSDPQQQYDIAQEVHLKQHAGINKTTAAIAIKYHWVRIKETVNRVIRDCPQCKET
FT                   LKSPPIPGTKDDDKSPSETMSGMDMNSTMEQPPKEPVNDPQAMDEAPDEPPSYNPLMHQ
FT                   PIPAAMPGTVHPMAGFAPMPLDPQIMQLQQQLRRYQQQNPMAGQFAPGPHNLGMSSFDD
FT                   AMRYHTASNAYQMMVDDGSDPFRQDVLGLVNPPAHELQHDAELLAKFEYGNPSDGNYDF
FT                   T"
FT   CDS_pept        join(375897..376709,376766..376779,376838..377646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948761"
FT                   /orf_name="Pc13g01610"
FT                   /product="Pc13g01610 protein"
FT                   /protein_id="CAP91230.1"
FT                   /db_xref="UniParc:UPI0001830771"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S1"
FT                   /transl_table=1
FT                   /translation="MSPKVTSRRALNSKLGIYVDXSGCDQNVSFRRTGWSPLSVFLIQV
FT                   SQFYCDRRAQILSTYAXDRIVFSRIFRGSTDATVFENFIAQLLALRKPVPKPVLVMDNA
FT                   SFRYSERIAHICVDVGVKLVYLPPYSPDLNPIQEFSAELKAFINDTKVVVNTDQGFITF
FT                   LGWCIDVVGAKEESAMGHFRHECLTIEAKGWK"
FT   CDS_pept        join(377961..378150,378214..380636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948762"
FT                   /orf_name="Pc13g01620"
FT                   /product="Pc13g01620 protein"
FT                   /protein_id="CAP91231.1"
FT                   /db_xref="UniParc:UPI0001830772"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S2"
FT                   /transl_table=1
FT                   /translation="MDLIPPSYESATDRDAWTIIARYIPSSDLCAASLVCHRWHGLFMP
FT                   FLWGDPASHFGTDNDAVYVALTRFRRTLKYARQEVRALTHTIHLPPALSEIYGGPRPGW
FT                   LRDILECLPCLQCLMVSKLPFFDHHAMTALKTNERSSHYNIRLLLAEREPNTTSASLAQ
FT                   TLLLFPVLTYLDLSYTTPARDRNVLSTLAQMPFLRVLKLRGIGLKDNDAEFLADAIGQR
FT                   VRCLDLRDNMLTDIAICSLLQKSFLPTSERERQQSPRPATASPDPFSHSAINESDSDFF
FT                   KRPDLDEQFAKLLAQPVLFHPWVEDLPYMGITHLYITGNRISLEAVASLLRSSRLHALD
FT                   FGTIKPPDKAHHTHPYGKEEYPGAETLVPVLGKIAGDNLTYLRAHHAVLTGQPQTQDAV
FT                   SDDEFLPELSAQESLREVEQFELDASQQVYELSEETRPVFELADTSTTESTGSYSTTKG
FT                   LKTSQMLTAHEDEPTPSVRRGPAFAPEVVQPIPIHSSANGGTAFAVSRTGTWNTEQTEG
FT                   STLPSISMSLDCDKLATDFSLQATLQCSSPISTNDSLEQKVQELLSKRPRNQSIPLQGG
FT                   KESWFPYLHPSHIPHMESLVLTDVPSHVTPNSSILSALTRFITACSNEALLATLQAGSD
FT                   YSLPPGRARMQAEQQRSRSLFGLRRLILEITPVDSTKLTSWKPANQYNATGHSSTGDRD
FT                   SENLWSAAANDFSFFGEEECGVPENDPGKYFPMAVLNEKVSLMPMEDDSLHSPDSPRLG
FT                   RHLPRSPQTPGPPMTAEDRKQQCQASMIDLVAELAAFRRGKKAEYERVVRRERERRSTL
FT                   GTGASGLLMPSSPHISLSHYVEGHWKGEVKIVRNPVPKVRTGTVDMYGNYFEKGYLYP"
FT   CDS_pept        join(complement(381731..381753),complement(381400..381527),
FT                   complement(381182..381284),complement(381011..381116))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948763"
FT                   /orf_name="Pc13g01630"
FT                   /product="Pc13g01630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91232.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI0001830773"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S3"
FT                   /transl_table=1
FT                   /translation="MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMV
FT                   ESAAIRDISEASVFAEYSVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRFN
FT                   KDGKKLQPPTAAKAL"
FT   CDS_pept        join(382422..382472,382550..383423,383476..383570,
FT                   383625..384452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977835"
FT                   /orf_name="Pc13g01640"
FT                   /product="Pc13g01640 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91233.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830774"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S4"
FT                   /transl_table=1
FT                   /translation="MSAASSRQRQNQSKRDEAIRRKMEADLSKKRNAPAKSRNSRKAPP
FT                   GTVLALKPSQALQIKPSMSIAEAAQLMAAKREDCVLVTDDNERIAGIFTAKDLAFRVVG
FT                   LGLKAREVSVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITK
FT                   CFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLD
FT                   GLPPVTVSVRTTVKDAAALMKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTC
FT                   SVVRVMTPHPDFAPSDMSIQAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQ
FT                   INTMSTQDDEGPAWNKFWLSMDHESDSMVSGGHSQQLNTPHRSVMSPDLARSGYDNSLL
FT                   PNDSASHHGDEHSEVISQHHPAEPAAPTPFPFKFKAPGGRVHRVNVLTTNGVTDLVSQV
FT                   TAKLGKEVEAVGGEPTVEEGRLSNTGYALSYMDNEGDTVSITTDQDMTDAIDLARRTHR
FT                   DKVNLFVHDPAQPPIPAPVEPQHVKIVTPIEEQSVVEESASQESPVSKALPQQQAVPAH
FT                   APEEQLIAGVPNDLLLPGAIVTLAAVIAGVFILSRPSGR"
FT   CDS_pept        join(385192..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..388840)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948764"
FT                   /orf_name="Pc13g01650"
FT                   /product="Pc13g01650 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP91234.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001830775"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S5"
FT                   /transl_table=1
FT                   /translation="MSLLPPEIHTALSQLLSALGTPDNAVRSQAEDQLNNDWVQNRPDV
FT                   LLMGLAEQLGGATDTITRAFAAVLFRRIATKTRKDPATGDNKEIFSSLPSEQRIAIREK
FT                   LVVCLTSETVTDVRKKIGDTLAEVARQYTDNDEQWPELLGVLFQASQSPDSGVRETAYR
FT                   VFTTTPGIIEKQHEDAVVEVFTKGFKDDNISVRISAMEAFASLFRSISKKSQPKFFGLM
FT                   PDLLNILPPLKESSESEELSSALLALVELAEISPKMFKPMFNNLVKFSISVVGDKELSD
FT                   QVRQNALELMATFADYAPNMCKKEPEFAQEMVTQCLSLMTDVGADDDDAEEWNASEDLE
FT                   PEENDLNHIAGEQCMDRLANKLGGQAILQPAFSWIPRMMSSTNWRDRHAALMAISAISE
FT                   GCRDLMVGELDQVLALVVPALQDPHPRVRYAGCNALGQMSTDFAGTMQEKYHEIVLTNI
FT                   IPVLASTEPRVQSHAAAALVNFCEEAERSTLEPYLGNLLSHLLELLRSPKRYLQEQALS
FT                   TIATIADSAEAAFDQYYTTLMPLLLNVLKEEQGKEYRLLRAKAMECATLIALAVGKEKM
FT                   GQDALNLVQILGHIQQNIVDADDPQSQYLLHCWGRMCRVLGQDFVPYLPGVMPPLLTVA
FT                   AAKADIQLLDDEDQIEQVEQDEGWELVPLKGKIIGIKTSALEDKNTAIELITIYAQILE
FT                   QNFEPYVLETMEKIAVPGLAFFFHDPVRVSAAKLIPQLLNSYKKAHGGQSPGFAEMWNK
FT                   VAEKIIEVLSAEPTVDTLAEMYQCFYESVEVVGRNSLTPQHLQAFIESAKSTLEDYQMR
FT                   VKQRLEEQAELEDGDEENLDFEYAVEDDQNLLSDMNKAFHTIFKSQGNSFLPTWQQLIP
FT                   FYDAFITSQDPTQRQWALCIMDDVLEFCGEESWAFKDHIMQPLASGLRDENAANRQAAA
FT                   YGVGVAAQKGGAAWSDFVAASLPSLFQVTQHAQSRTEENVFATENASASIAKILHYNPS
FT                   KVQAPQDVVTNWIETLPITYDEEAAPYAYSFIAQLIDQQNPAVFAKADRVFGFIVQALE
FT                   AATLQGQTAARVATSAKQLVAVTGANADQILASVDPASQERVRKFFQ"
FT   sig_peptide     385192..385251
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S5 "
FT   mat_peptide     join(385252..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..388837)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S5 "
FT   CDS_pept        join(complement(390005..390233),complement(389534..389906),
FT                   complement(389102..389456))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824608"
FT                   /orf_name="Pc13g01660"
FT                   /product="Pc13g01660 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91235.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830776"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S6"
FT                   /transl_table=1
FT                   /translation="MSLAKDILLFGATGTIGSFILDAILTERPQFGRVAIFTSPHTAEA
FT                   KASQLNKLKEQGVEVIVGNVEDENDVKAAYEGIDTVISALGRNALAQQIPLIRLAAASP
FT                   TVKWFLPSEYGTDIKYGPASANEKPHQLKLKVRAYLEDEISRDDLAYSYVVTGPFAEMY
FT                   LNLLPGMEEAGGWDVKGRRAVLLGEEGKGEVSLTTMTDVGTLVLNTLLHATAETRNAAL
FT                   CVNSFTTGPDQIQAEFERQLGGQPWDVSRTSLAKLREAEAAAWDAGNPAATVLTLRRIW
FT                   GEGGTLYSERANGLIGEPKMMGLEEVVANEIQRVSKL"
FT   CDS_pept        join(complement(391847..392731),complement(391606..391785),
FT                   complement(390574..391440))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948765"
FT                   /orf_name="Pc13g01670"
FT                   /product="Pc13g01670 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91236.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI0001830777"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7"
FT                   /transl_table=1
FT                   /translation="MAQLYWPSVVLILWSLFSLSTADTCWRETTCSGPTNTAFSGPWEK
FT                   NIYAPASRTVRPASTLSELKTNAVTDPAHPYKATLYGNGSIIVFDFGIEVGGIVHLDYT
FT                   STGSGALGLAFTEAKNWIGEWSDSSSALYHDGALYANISSTGKGTYVMPDKYLRGGFRY
FT                   LTVFLLTDYSTSVQIEDLTLELAFKPTWANLRAYQGYFHCSDELLNRIWYSGAYTLQTN
FT                   EVSVDTGRVTKGVTSGWVNNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDL
FT                   ESVKSALQIMYNTQNKTTGAFDESGPPLSQKGSDTYHMWSMIGTYKYVLYTNDTDFLFK
FT                   NWASYQHAMEYIYGKTGASLALWAGDSTNLSSIWSSQAANLKKAINTYCWDESYGAFKD
FT                   NATNTSLHPQDANSMAIMFGVVNEERTASISEKLLKNWTPIGAVAPELPENIASFISSF
FT                   EIQSHFIAHKPARALDLIRRSWGWYINNPNGTESTVIEGYLQNGTFGYRMDRGYGYDPS
FT                   YVSHAHGWSSGPTSALTEYVVGLSVVSPLGLTWKIAPQFGDLEFAEAGFVTSLGKFQAS
FT                   WILNSSGYVLTFSVPKGTDGNVTLPYVTASKKPSITIDGDQLMRGVAYADGAATVEVTG
FT                   GSHKVVVT"
FT   mat_peptide     join(complement(391847..392665),complement(391606..391785),
FT                   complement(390577..391440))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7 "
FT   sig_peptide     complement(392666..392731)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7 "
FT   CDS_pept        join(393481..393828,393954..394460,394537..394908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948766"
FT                   /orf_name="Pc13g01680"
FT                   /product="Pc13g01680 protein"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91237.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniParc:UPI0001830778"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S8"
FT                   /transl_table=1
FT                   /translation="MSGETVRPAFEGRERPLLSYGIAFPAATARHLDGTFRASRVYVIC
FT                   SGSLSRNTNVMDQLETALEPDRLVGHWIGMRSHTLWSEVLQIAEEVQTAHADLLLTVGA
FT                   GSLTDGAKIIALVLANRVSTPEELETLAEGPKKRKYIEAPTLPIISVPTSLSAGEYSNF
FT                   AGGTEDHSKRKYSFQPPIRGPELVILDPWLAKTSPGSIWLSTGVRAMDHCIESLCAIAG
FT                   TTTKSDKLALNALGLLVPGLLRCKRDRSDREAHLQCQLGSVDAMAACTSGSIELGASHG
FT                   IGHQLGPLGVGHGETSCILLPAVCKFNAKYNANREKQARVRQFLIQDPIVSDVLRARSV
FT                   NVETSDLGDILDAIIRELGMPRSLSDVQVGRDQLDGLAENSLHDRWCKTNPVPLKEKSQ
FT                   VLEILEMVV"
FT   CDS_pept        395829..397076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949802"
FT                   /orf_name="Pc13g01690"
FT                   /product="Pc13g01690 protein"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAP91238.1"
FT                   /db_xref="GO:0016872"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI0001830779"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S9"
FT                   /transl_table=1
FT                   /translation="MASTLRQNPWWAYQSLTRQQLRTSRLSSRHLSTTPLRSNASNNPL
FT                   RSRASAAADLQHAAQAQRRMILSAAGIITCAAGLYGVIKLDLFGLNELDTNKDDKTTPP
FT                   KNGAMRMDGPVGFTNGGPSLITIKGQDRLEQVPTGTSTIPTFPSTIRLPTPEATEGKQT
FT                   GDDLAPSAGEEYQLLGLGIRTVSFLSIQVYVVGLYVAKSDITELQRRLLRTAIHPPTTD
FT                   DDAAISGAGATAATSLVSPERQQLRELLLDPEHGDAAWSAIIKDNGIRTAFRIVPTRNT
FT                   DFMHLRDGWVRGITARAQAKKTAEPGEFQDESFGSSMNDFKAVFGSGKGKSVPKGQTLV
FT                   LMRDAHGALDALFQPGADKPVKWMGRVADERISRLVWLNYLAGKNVSSEGARASIVDGL
FT                   MTIVERPLGTVVQKVI"
FT   CDS_pept        join(complement(397712..397862),complement(397430..397584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978061"
FT                   /orf_name="Pc13g01700"
FT                   /product="Pc13g01700 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91239.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183077A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T0"
FT                   /transl_table=1
FT                   /translation="MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTL
FT                   ELDLEEEGAAIQSALAEISSQRTVPNIFINKKHIGGNSDLQGKKDLKDLLKEAGAI"
FT   CDS_pept        join(397909..397920,397979..398050,398152..398205,
FT                   398355..398497,398559..398691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129221"
FT                   /orf_name="Pc13g01710"
FT                   /product="Putative uncharacterized protein Pc13g01710 "
FT                   /protein_id="CAP91240.1"
FT                   /db_xref="UniParc:UPI000183077B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T1"
FT                   /transl_table=1
FT                   /translation="MDEMGGVRDDERIGGRFRQISGIERCDDLVAAKYILIYLTRRLVG
FT                   EADQTKERGEIASKKAWEYGKTGFKDVSERNPKIGEKKRNHRVKKVTGRFESLIPILSI
FT                   AIWSELFRIPSYHFGRKNNGHRRREEKYQGMDA"
FT   CDS_pept        join(complement(400538..400568),complement(398967..400465))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824869"
FT                   /orf_name="Pc13g01720"
FT                   /product="Pc13g01720 protein"
FT                   /protein_id="CAP91241.1"
FT                   /db_xref="UniParc:UPI000183077C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T2"
FT                   /transl_table=1
FT                   /translation="MGFCGATCEREKKALISFSPQENHSSKQRNSHDSNSVRPKFSRQR
FT                   TSNGSRSSSVSRTARTHESPYLASNRGRREPSLNRHGSEAGSMRDAFGHEAASRKETEE
FT                   ANDGESYLDGKTNQEKWIHRDKLAKIESEELHQAAILFQRRMRGESKSSSGRGRSHDAH
FT                   PANGTGTATSPATEYSEPWPKVKEESGKQDVNDNVEDDEREHWDLRRPEEIAADDAAAS
FT                   IYSHPSLGKSASRIPVSTASPVPISAALGRDSRSSRSRAATDEEDRSSRSRRASEPINI
FT                   EQDGSTPSPESRPGSRGFSSTPNTLGKKTVKPTTGSTNRKTSAPPTNRKASTPRSRAVS
FT                   GNNIQRPTTRGGEPRPSTAVNRPEGDPPWLATMYKPDPRLPPDQQMIPTVAKRIMQEQW
FT                   EKEGRTPNTYDRNFEPLAVHPPDAPPAATKAEPEQQPVESLQLEELPPQPPKSPEPPRP
FT                   NTSTGYSTMPKVQDTPPMGLTPNPNPNWSPPVVTAQQAPKKEKSCGCCVVM"
FT   CDS_pept        complement(401778..402719)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129222"
FT                   /orf_name="Pc13g01730"
FT                   /product="Pc13g01730 protein"
FT                   /biological_process="apoptosis"
FT                   /protein_id="CAP91242.1"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0001830839"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T3"
FT                   /transl_table=1
FT                   /translation="MSWRNPLKMLRRSPSYAPASNPQVSDGDFSYIAPSDIADPAADDA
FT                   EPDIIALRHRGTIYPLRFRAYSIDDNVLTIGDLRQAAAESTGAGHPDCVRLLYKGKLLK
FT                   NNAQTCKAEGLKQHSEVLCVVSEAGAGSPSDGSDDGHKIPVTTSAPTPPPLPRPTSAGD
FT                   ASSPPTPPSGKSKSSRRKKRNGKKSPVSSEAPGPSRPPRPTSSGHSAASAQPPNLKLLN
FT                   TPLEKIAALTGWFEQVMKPQCEEYTANPPSDPKKRGDEHRKLSETVLQSVQLVADGIEP
FT                   NGDETVRSARRALIRDSQAVLTELDRVLHSVA"
FT   tRNA            403657..403765
FT                   /gene_name="tRNA:Met (CAU)"
FT                   /anticodon=(pos:403691..403693,aa:Met)
FT   CDS_pept        join(404979..405030,405216..405356,405459..405589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949803"
FT                   /orf_name="Pc13g01740"
FT                   /product="Putative uncharacterized protein Pc13g01740 "
FT                   /protein_id="CAP91243.1"
FT                   /db_xref="UniParc:UPI000183083A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T4"
FT                   /transl_table=1
FT                   /translation="MEDDKPLAVTAIHVATPLWVTCTRRLCRLRHIACTQHFVVIANIY
FT                   APPALILLSGWMQLPVICQAYGCLVVGHATTDEKYRSDRNVIQPRYGPGAFCGVQTPCL
FT                   AVS"
FT   tRNA            406230..406338
FT                   /gene_name="tRNA:Met (CAU)"
FT                   /anticodon=(pos:406264..406266,aa:Met)
FT   tRNA            407427..407535
FT                   /gene_name="tRNA:Met (CAU)"
FT                   /anticodon=(pos:407461..407463,aa:Met)
FT   CDS_pept        join(complement(409596..409903),complement(407803..409537))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978062"
FT                   /orf_name="Pc13g01750"
FT                   /product="Pc13g01750 protein"
FT                   /protein_id="CAP91244.1"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniParc:UPI000183083B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5"
FT                   /transl_table=1
FT                   /translation="MFPVSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYL
FT                   SVPIFLALALPASVVLLVPIDLASSSRDGSGPKAIWLPERMVLVCWRIAYWLIFVLTWV
FT                   ILPLLGEYVDSGYREPKGRLMYSLRSNAKYQLIVLGCALVGLVYVSISNGFEFRSIKGL
FT                   IMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPRVHDRLMDSVNEL
FT                   ANLNSQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRIPILESPDTSATIPSVITERY
FT                   LADLTRRLQRARHMKARFVDEWDRLVQLSADLQAIINSTASKKLEFAPAARRSSCIPRV
FT                   KFLNPYMRYQLYSNVIPSVRLAFGAFFAVASVCIVWSEMIKSLAPHLSAISLTVVPNWK
FT                   DSPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWYAGLVARLT
FT                   VPIAYNFLTFLPKDFRRSTTFYEFLGKLINLTPLGKGFDFIFPIFILLPICATLFNLYG
FT                   RIKNIFGCGLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGSRSTW
FT                   ASDRDDEGSPGSSRLRVPVAEGSQPAQRSVVAPTIVGGEEDDDENFFQSFAHRVKNTFD
FT                   TTNTPRWFQGEPFRLPRWMSGDNNTTEEGSALFGGRAVPGRLRLG"
FT   mat_peptide     join(complement(409596..409783),complement(407806..409537))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5 "
FT   sig_peptide     complement(409784..409903)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5 "
FT   CDS_pept        join(complement(411465..411494),complement(411300..411386),
FT                   complement(410897..411250),complement(410604..410666),
FT                   complement(410154..410276))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129223"
FT                   /orf_name="Pc13g01760"
FT                   /product="Putative uncharacterized protein Pc13g01760 "
FT                   /protein_id="CAP91245.1"
FT                   /db_xref="UniParc:UPI000183083C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T7"
FT                   /transl_table=1
FT                   /translation="MGDQWAIRAEEVQHGLISGREKKGKQVLVWNRDSSRSGRGTNTNT
FT                   DQHNEESKAFGQQRQMNSIRWPPPDCGLERMKTVVGWIGSVTGIMQPSSRTGPQLLSSL
FT                   HNGETIGGLKDKEHRYLRKIRMTLRQRQMSAQISLSWGAQSKKKWRSSEGYYDGGHKAS
FT                   SEVLPVLPGFPLLGQFSSRSTRRSGPDLIRRNQLVKMPETLPGGCGRVPGTPLYT"
FT   CDS_pept        join(411592..411725,411803..414686,414741..416087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949804"
FT                   /orf_name="Pc13g01770"
FT                   /product="Pc13g01770 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP91246.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183083D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T8"
FT                   /transl_table=1
FT                   /translation="MQVPKNDSVQSMMTYVAQMLQNQGPFQGWKADVLIKTRATNVYQM
FT                   ITSLRLIQPRIDLHQAAQAAMSFELKAFTKANEKIEYEKECTEKLLHIRNTRERQAAVA
FT                   YQSGMMPQTGAGPNQIPAAFPQHIPVSGQQQLAMGMNGQNQQAALQRQQQQQQSHAMLQ
FT                   QQQQQQQQQQQQQQQQQQRSQQRPGNGIPMVDDLSTLSAQDLDHVSRLANEMLNKTNPE
FT                   DMEKIKMNLSNMTPEQRQYLARKNLEPMTYFFRSQALNQIRRHRRARLEMGGRAPNPGV
FT                   DANGNMMGDPMMNSQHQRQMLQNMLNLQRNSAFPGNPGQTMDPPNFIGNVENIQGQQAD
FT                   GLRSQEAGQLVVPASSSQMNQAPFPNNNNNMFPQQMGQNGQANMNANNPNAQAQFLAQQ
FT                   HLQGGSNTPQDRLQFQAQQSQAQAQAQARVQAAQKAQMAMSGHGGQVTPQSQPQLNGQS
FT                   PVMPMLNQPMAPGQMSPVQVPAQARPPSRPANMGQHPAGVAGQAAMQGPLQIPSNIPPH
FT                   IQEQLARMPPEQARAFIMQQQRRAALNNMARANPGQQPQPQPGQAQSMMNNQMGNAIMR
FT                   GSMSGPQDLNSGGMPQGQQMTQQQRQQRQNELYKLQLLRQQNNGVEMTPEQGKQMDRVS
FT                   FPPSILNMNGTSMQVPSNIKSWGQLKQWANSNPQIASPNDLPRLMMLQKLHLGQLISAS
FT                   TNQPKDQNGQGPAATPFQGTQVPFNNAPGFLPGQQPGAMNMAAMRPITAQDIQMARQKL
FT                   GHQASNFTDEQIREILLRNRQKQMMQAAQNRAMQLEGNTQAGQLSQPATQPPVPTAQPV
FT                   PQIKPQNAQPPQSTPQAANAKAQTGAATKGAKGATGKQASKKRPSTDDTTEARATATPQ
FT                   MNQPVAVPGGPATAPQRPAFPFTQEQLAQMTPQQRAQVEAHMRSKQPQSRGQVLSRAAA
FT                   EEAWNRNLPPQVMEVYNDIAKNAPPAKPIPVSPEQKAAMTKQLREAVEVLGRLDALVQW
FT                   FAKMQGQEKNVKNLLAMRIQLMRQFKPSQEWGVNEQFTVTPDYLTGAILFMRKLFAVMI
FT                   SRMQQGQRPTSQAPSSNGQQMPGNMPALNATNLQQLQAQEEALQRARRASSQSAANAPA
FT                   APFAAPSPRGVPQYAAGGLAPENLKLPPPKKRKQSHGVASSPVQATAPPGAAAKYNKAV
FT                   ADATSNAAAMAGAFKCSVVECQHHYQGFPTQAVLDKHVEESHQPEEEETIEDPLKYYHE
FT                   SISMGLGLNSDDSPETQQMATLGPVPSSTKPSAAASPAKQGVSTPLIANNTPMARVTSQ
FT                   FGGKTASPAAASTQLLTPQLSSVKGSKPADKDGKKDAIKLEDSDTKDPWAECPTSLDTI
FT                   HDTFSNLASKDLPHLGYDSLEDFDINEATPVDDDWAAFASLTPPNEAEEAAFLEKFYEP
FT                   WDEDSIARAADWMRIPPEIQVKGIGPMGQLEVDWDAVARYEREGIRIRQTSK"
FT   CDS_pept        join(416680..416763,416821..416897,416972..417856,
FT                   417912..418185)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949805"
FT                   /orf_name="Pc13g01780"
FT                   /product="Pc13g01780 protein"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91247.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="InterPro:IPR012404"
FT                   /db_xref="UniParc:UPI000183083E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T9"
FT                   /transl_table=1
FT                   /translation="MANNALIPLLVTMMLVTGVCNTILNKYQDMQCVRNCDSPDPNQRK
FT                   LFEQPVIQTAVMFIGEMGCWLVVGLNFVYRQYIAPRLSSDPSPLLTGGYHPINGYDEGI
FT                   DNEDDHTVDGLDSDSRHPKPLPEIDSRIPLRGLKVLLLAAPSSCDIAGTTLMNVGLLFV
FT                   AASIYQMTRGALVLFVGLFSVLFLRRRLHLYQWSALFIVVLGVAIVGLSGALFSGDSGH
FT                   DINQNASVTDVASRALIQARDVARTPEAVQTIIGVLLIAAAQIFTATQFVLEEWILEHY
FT                   AMEPIHVVGWEGVFGFLVTVVGMLIMYLIVGRTDAGRYGYFDVKQGLHELLANRAVAIS
FT                   SVFIMISIGGFNFFGLSVTRTVSATSRSTIDTCRTLFIWIVSLGLGWETFKWLQVVGFA
FT                   LLVYGTFMFNDIVRPPIKACLPRDRREGEVLLPEGPIEHI"
FT   sig_peptide     416680..416742
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T9 "
FT   mat_peptide     join(416743..416763,416821..416897,416972..417856,
FT                   417912..418182)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T9 "
FT   CDS_pept        join(complement(421451..421596),complement(421206..421394),
FT                   complement(419021..421154),complement(418852..418947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949806"
FT                   /orf_name="Pc13g01790"
FT                   /product="Pc13g01790 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAP91248.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI000183083F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U0"
FT                   /transl_table=1
FT                   /translation="MQSNISTVKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCTLGNIASVEMSRDLFPEVESLMSTANPYIRRKAAIC
FT                   AMRICRKVPDLYEHFLEKAKNLLSDRNHGVLLCGLTLAIDLCEAEEEEEEEEEGGPVGV
FT                   IEMFRPLAGGLVRALKGLTTSGYAPEHDVSGITDPFLQVKILRFLRVLGRGDVATSELI
FT                   NDILAQVATNTDSSKNVGNSILYEAVLTILDIEADSGLRVLGVNILGKFLANKDNNIRY
FT                   VALNTLNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINEDNVRVLVREL
FT                   LAFLEVADNEFKSVMTTQIGIAADRFAPNKRWHMDTILRVLKLAGNYVKEQILSSFVRL
FT                   IATTPDLQTYAVQKLYSSLKEDISQEGLTLAATWTIGEYADSLLQGGQYEEEELVKEVR
FT                   ESDIVDLFTNILNSTYASQIAVEYIITASMKLTVRMSDPAQIERLRRLLSSRTADLSVE
FT                   IQQRAVEYTNLFGYDQIRRGVLERMPPPEIREEQRVLGAAPAAKKRQSKLLRGKSTTKV
FT                   AKPAEHDLLLDLVGGSDAPVTSPTSGGSNTADLLADILGGDSGMSSPSPGPAGQKNAIM
FT                   DLFGSNGPSPSPQPTQPTSASMDLLGAGGMGVSAPSPTTSPAPVTASTPAHTALNKDGL
FT                   VLTLQVQRSGNIAQILARFRNDSNFDRFTSVGLQAAVPKSQRLQLSAITKADLEAGDEG
FT                   TQSLRVTALNGGLPAKLRLRLRVTCARDGGNPVTDQVDWSEP"
FT   CDS_pept        join(422422..422543,422615..423058,423120..423827,
FT                   423884..424220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949807"
FT                   /orf_name="Pc13g01800"
FT                   /product="Pc13g01800 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91249.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0001830840"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U1"
FT                   /transl_table=1
FT                   /translation="MSSAVSQNESATLRPRAVPIQHGKSDVALPLPVDKLAQDTSGRST
FT                   PVSEDAPPSAHSISSARKQVRARNRLFYTINYVPRVSHFDPDSDYHNFRGFFTLFWIGL
FT                   AIMVGTSILRNIKDTGYPLQVRVWSLLTANVWGMGLSDAAMVISSGLVLPMHRLWRAGP
FT                   QWLRWSRGGMVLQSLGEAFWLVLWINWPFMMRWTWTAQVFFTLHTLTILMKLHSYAFYN
FT                   GHLSETQRRLASLDKPGSKTPEQPAAIHYPEVHRRRPSMKQRDEDQSTEPLERLREDLA
FT                   TELTSPLGNISYPQNLHIGNYVDFLFCPTLCYELEYPRRKERRWSEIGWKAAAVFGCIF
FT                   LLTLTSEEFIVPVLAEASSQLRVVSSATDKALVLAETISMLLFPFMIIFLLVFLVIFEY
FT                   VLGAFAELTRFADRHFYADWWNSCDWMEFSREWNVPVHHFLFRHVYWPARCNFSQPVAM
FT                   VITFLVSSIFHELVMSCITKKLRGYGFLAMMLQLPIVAIQKSRFFRGRTILNVGCHLFS
FT                   LVFSGLTDFLSRMHSSGPR"
FT   CDS_pept        425288..425443
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        425534..426013
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949808"
FT                   /orf_name="Pc13g01820"
FT                   /product="Putative uncharacterized protein Pc13g01820 "
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91251.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="UniParc:UPI0001830841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U2"
FT                   /transl_table=1
FT                   /translation="MGQFEHFFPIENLTEAGKGYFNYALCQSDRMRPYQLDNPIEEGLR
FT                   GVYLSDDVTVNLLANASGIFATLEYSWIPSYNNYTLQWFYQDLLEEIFLIFGEKYNVRP
FT                   HWNKMLFNDGTYASNIYPKINSWLDIQEQMDPHCQFVNEFLAESLGIERCVSLFQ"
FT   CDS_pept        join(complement(428571..428845),complement(427238..428495))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978063"
FT                   /orf_name="Pc13g01830"
FT                   /product="Pc13g01830 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91252.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830842"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U3"
FT                   /transl_table=1
FT                   /translation="MSTPPDIDPYAVLGVAKEATIPEIRAAHRKRVLKCHPDKIQDESQ
FT                   RIAAQDEFQKVQQAYELLSDDVRRTKHDQKVKIAELKRELLERRRTEVPMEVFFEEAMR
FT                   FTDEPRTMSRKFEDFGVRSKSKPTEEKKKARAPTSTYHQAKEKRETAKATHSDRAKTRD
FT                   QERRRQRQAEAKYDSTFDVCAESDDASDSSVPRYAHKRTSTPRRERERDSRSRPSESSR
FT                   RRERRYDEDDDISDHWQSKIESQYFNAEDYIASKTRKSKSPRRYHGHDSAEPESSTSRS
FT                   AGRSTRTRRRSSSRDRSYEHLESPRAYEVKPPKMQPSATSPGIKVPLRPSFLNTRAATS
FT                   SGFRQKRESRDSTLYEMAHEPLPSRTSKMRDRNDSGYSSPGTPEMLPRGTSPKTLYTVV
FT                   QEADHVVVEPKSSKYRSARSPDRDRVPSTRQVPKRSSTFQAYTEAAPRVETRSARPSSR
FT                   THPVEYITTAPKGNVKYGRTYKPEDVSYSPRRDYYYDEEYRPPAVGRRQSAY"
FT   CDS_pept        join(430311..430393,430474..430549,430684..430770,
FT                   430841..430921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129224"
FT                   /orf_name="Pc13g01840"
FT                   /product="Putative uncharacterized protein Pc13g01840 "
FT                   /protein_id="CAP91253.1"
FT                   /db_xref="UniParc:UPI0001830843"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U4"
FT                   /transl_table=1
FT                   /translation="MLNGAACASPDHDESIGKSANAERVNAVLPVILLFCVKVSYVLAQ
FT                   EWPTIHSNAIIALDHSHSFQPDCASRIHNPPIPSVVLLPLFPDSHANPARTGLGWIHNW
FT                   TLAA"
FT   CDS_pept        join(431451..431615,431687..431737,431858..431953)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949809"
FT                   /orf_name="Pc13g01850"
FT                   /product="Putative uncharacterized protein Pc13g01850 "
FT                   /protein_id="CAP91254.1"
FT                   /db_xref="UniParc:UPI0001830844"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A5"
FT                   /transl_table=1
FT                   /translation="MAGRAIYWLAQRFVLFTAENSATGRSFGSAALSGSFEFGEIPVAD
FT                   DLRTSYWELTMGLYIACGVYSGHETRGYGAYARVALTPGLSDGFNYHPRGQRGAQFKK"
FT   sig_peptide     431451..431522
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A5 "
FT   mat_peptide     join(431523..431615,431687..431737,431858..431950)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A5 "
FT   CDS_pept        join(complement(433317..433512),complement(432227..433170))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949810"
FT                   /orf_name="Pc13g01860"
FT                   /product="Pc13g01860 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91255.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001830845"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A6"
FT                   /transl_table=1
FT                   /translation="MRQKTRFVCVSDTHGYTPSETGFKLPAGDVLIHAGDLTNNGSLKE
FT                   LCRTMDWICKADFEIKIIVGGNHDVTLDQAFYREHGARFHGQHLEDSYHCLNLIMESPS
FT                   VVLLRHEPALIRLTRADGPNTVFKIFGSPYSQSPGNWAFGYESNDAAALWAQIPIDTDI
FT                   VVTHTPPQSHCDQKPNGMFVGCAALRSALSLIRPHLAVCGHVHEGRGYERVRWRGNLIN
FT                   TEIETETGPESDSVDHVTRGVLPPMGSKKQSLVDLTGKRDKRLDNEGFSHPRPRQHDLT
FT                   ETQPISSASPGSESSAGVPEKASQRNSPSTHPSLGAGSPGPNSRGFDYALQTLRKETCI
FT                   VNAAIMSTSWPHQGGKRFNSPIVVDLELPVWQNHAVANG"
FT   CDS_pept        join(434279..434299,434391..434526,434732..435044,
FT                   435116..435254)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949811"
FT                   /orf_name="Pc13g01870"
FT                   /product="Pc13g01870 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP91256.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="UniParc:UPI0001830846"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A7"
FT                   /transl_table=1
FT                   /translation="MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNIS
FT                   GEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMIPHKTARGAAAMERL
FT                   KVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRK
FT                   VKSKAYYERKKAARRVLAKAEQGANVDSKTKTQLAQYGY"
FT   CDS_pept        complement(435946..437340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949812"
FT                   /orf_name="Pc13g01880"
FT                   /product="Pc13g01880 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91257.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniParc:UPI0001830847"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A8"
FT                   /transl_table=1
FT                   /translation="MLIHLLQSLRISQNGPLVIRGAIVLILPLCILLAVVIQSGNIHTT
FT                   RRRLRHLQKLGLTTSNMADQYNPKFCLPPGTAIDGAPRIKAIYLHPIKSCGPVEVDRAL
FT                   LTKSGFMYDRCFAFATKSVTGDDTAASKWKFISQRKNPVMSRVKTELWLPHKYSNLRDP
FT                   LVQSGGCVVMTFEDPDLPSWTSRVETFFHTRNLSAPSQLSFIVPLDVTAAQAKLKTFGI
FT                   HSRDAKGLDIGGIPSIAAALPKLKKFLGIPADQMLTLFKCTPDTLTRTDKNLAPLEHIG
FT                   SPALHGYTDQQPVNINSLSSVHAVSALLPTENQPLNALRFRANIWIINAPAYEEETWKR
FT                   YRILPKSNGTQPRASVAPALSVVCRTSRCTMPNVNPETGSFDADTPPPGRKRGKAQPST
FT                   TLVQYRTVETGNKAALGYLGMHCVPEDGSLKSAEEQGAGLYIEVGDEIEVLERGAHLYG
FT                   STGDDY"
FT   CDS_pept        join(438241..438378,438440..438635,438688..439134,
FT                   439203..439832,439888..440195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824870"
FT                   /orf_name="Pc13g01890"
FT                   /product="Pc13g01890 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91258.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI0001830904"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A9"
FT                   /transl_table=1
FT                   /translation="MSGSKSRLSGLLGHFTGSTPPVEHRVNTHTLSPTFFLPRAAAVEP
FT                   NAEAIYHVTANNKILRRSYGETADRARGMAYYLKKHGLSRVGILCPNTPAFLESIFGIA
FT                   AAGAVNIAVNYRLKQEDIAYIFDHGDAEVIIVDEEYVPLLEHYRSQHPRIPIIVDTDTD
FT                   ATEGELTGPFDEAVLEGLRHDIDTGSRGWEGLESQAADEESTIALAYTSGTTARPKGVE
FT                   FSHRGCYLATLGNVIETGLNYHRGRARYLWTLPMFHAMGWTFPWAVTAVRGTHYCLRKI
FT                   DYPEIWRLLKEEHITHFNAAPTVNTLLCNAKEAERLPEPVRVTVAASPPTPLLFEQMTD
FT                   LNLHPVHVYGMTETYGPITKGYHLPEWDELPLKDKYQRMARQGHGFITSLPARVIKTEV
FT                   PAGTITDVRKDGQEIGEIVFVGNICARGYYKDPEATRKLFAGGVLHSGDLAVWHPDGAI
FT                   QILDRAKDIIISGGENISSVALESMLVMHPDILEAGVVAVPDSHWGERPKAFVTVKEGK
FT                   SLQGSDLIDWARNTSGISKFMIPREVEVVTELPKTSTGKIRKNILRDWVKGPREA"
FT   CDS_pept        join(440999..441730,441788..442471,442526..442873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949813"
FT                   /orf_name="Pc13g01900"
FT                   /product="Pc13g01900 protein"
FT                   /protein_id="CAP91259.1"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001830905"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B0"
FT                   /transl_table=1
FT                   /translation="MHRLREAGRCPSAAPSETSGSTSPERAADDDTDFFMAQANDSQSS
FT                   IGVANFRDSRLSSEPSEPLPPIGRLPPEILIAIFSKLAAPLDMLNSMLVCRGWAANSVG
FT                   ILWHRPTCNTWANVRSVTTSLGKPDSLFNYADLIKRLNLSALSDDVSDGTILSFNQCKR
FT                   IERLTLTSCKNLTDKGVSDLVEGNRHLQALDVSDLRHLTDHTLATVSRDCPRLQGLNIT
FT                   GCSKVTDDALLIVSQKCRQIKRLKLNGVSNVSDRAIQSFAENCPSILEIDLHDCKLVTS
FT                   ASVTPLLTTLRHLRELRLAHCTELDDTAFLSLPPQVTFDSLRILDLTACENVRDDSVER
FT                   IVRAAPRLRNLVLAKCRFITDRSVMAICRLGKNLHYVHLGHCSNITDSAVISLVKSCNR
FT                   IRYIDLACCNLLTDRSVQQLATLPKLRRIGLVKCQAITDQSILALARPKIGHHPSVSSL
FT                   ERVHLSYCVQLRMKGIHALLNSCPRLTHLSLTGVQEFLRENLTVFCREAPPEFTQQQRD
FT                   VFCVFSGDGVNRLRDHLNRHEPQFQEEAEATMYDDDEELDEDEGQMTGLMNATVINDGD
FT                   DDYIDVGPLNT"
FT   CDS_pept        443096..443572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129225"
FT                   /orf_name="Pc13g01910"
FT                   /product="Pc13g01910 protein"
FT                   /protein_id="CAP91260.1"
FT                   /db_xref="UniParc:UPI0001830906"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B1"
FT                   /transl_table=1
FT                   /translation="MCNRIEFKQFSFLSFIIPQFNDCSCVSVADLRSRPAYVVVYTGRL
FT                   FSDSMWDSLGMNPFSPGLPTLNIPEITDPSTFDIGVTTDTVNPRSTLEISRARDLVFTR
FT                   LSSLQQTLPHRRMDGTLQSVIAIWEEYDSRKADSSSIVHWLDVMREKGLVITLW"
FT   CDS_pept        join(complement(445074..445433),complement(443747..445030))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949814"
FT                   /orf_name="Pc13g01920"
FT                   /product="Pc13g01920 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91261.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830907"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B2"
FT                   /transl_table=1
FT                   /translation="MWPLNSKKDDNDTKIANPEPETKDDLESAHIEKIDASIDNIATSI
FT                   DNLPVSWFVWLAALTASMAGLLFGYDTGIISGVLVVLGDSLDGRPATSSEKEMITSLCS
FT                   GGAFIGAIFAGNTADRFGRKMAIYLGCVLFIAGAVLQAAAYTIVQMAIGRLVIGFGVGC
FT                   GAMVLPLYVAEIAPAKARGKLIGLNNMSITGGQVISYAIGAAFASVPHGWRYMVGLGGV
FT                   PAVVLGVLMPFCPESPRHLAYNGRRDEARVVLRKIYAKATEDQIDAVLLSICTACDQAR
FT                   EINESGSRFSKIKKLHTVPSNLRALVSACGLMVISQLSGFNALMYYSATLFSLVGFDNP
FT                   TAVGLVVAGTNFIMTFVNMMVIDGMGRRKLLLSTVWGMSVGMVAIAVAFRWIPINMETM
FT                   EVTTTGISPAAIAVLVFIIWFVVFYGVSVGNTAWMSTDFFPLEVRAMGTMWLTCSNWGA
FT                   NVIISSTFLSMMKAWTTSGAFGFFAAICGLGYIWIYFFYPEVSGLVLEEVKEVFEHGFG
FT                   VDYARQLRKERKDIIEERMKTQEKPIAVGH"
FT   mat_peptide     join(complement(448110..448449),complement(446265..448036))
FT   CDS_pept        join(complement(448110..448506),complement(446823..448036))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949815"
FT                   /orf_name="Pc13g01930"
FT                   /product="Pc13g01930 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91262.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001830908"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B3"
FT                   /transl_table=1
FT                   /translation="MGFCNWATVIANLLVPLGILTFSSGFFPYKPLIPGLATFDETGEN
FT                   VTVPAVFDKVIFMVVDALRRCLHIATLYIRMTRVSYLHRGDLIRSGAALPFTAYASAPT
FT                   VTMPRLKAITTGSVPSFLDVILNIAESDTTSTLAYQDTWLAQLKAIGGRLVMYGDDTWL
FT                   KLFPGMFDRADGTTSFFVSDFTEVDHNVTRHVPNELARDDWSALIMHYLGLDHIGHKAG
FT                   PKSPFMLPKQHEMDSVVTDIYTAMQQQHHLQSTLFVLCGDHGMNEAGNHGGSSAGETSP
FT                   ALLLMSPKFEALGRRESPVEPSGDMQYYQTVEQADIAPTLAGLLGIPIPLNSLGVFIPD
FT                   FLDMWDNGSHKLRILRQNAEQLLNTLTTTFPGFTFDSDISTSCASEALSAIEEARCAWA
FT                   RVQRLIYDKDEAGDSYSTVGPALLHFLRIAQEVMSRTASNYDVSRLILGLLITGAAGLL
FT                   VLPATYKECTRHGSSGLFLMLMIVTCGMMMFASSYVEEEQQFWYWICSGWIVYLHIKSQ
FT                   SSAKPVSHKRFGSLLYCIFRPHDTIHETLHIFLMTQSRATNVPLFLIFRIQAGILSSMN
FT                   LTGIEVTITTLVFQYMTFFAFGGSNAISSVDLASGYNGVGSYSVVLVGVLTFASNWAGP
FT                   IWWASQSHRLRPKNPAEQNPSALLTFHVAMSLVSVMAACTALRTHLFIWTVFSPKYLYS
FT                   MAWATANHVAVNLLGEAIFSRSQSRYHYS"
FT   mat_peptide     join(complement(448110..448449),complement(446826..448036))
FT   sig_peptide     complement(448450..448506)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B3 "
FT   CDS_pept        449919..451004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949816"
FT                   /orf_name="Pc13g01940"
FT                   /product="Pc13g01940 protein"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91263.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI0001830909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B4"
FT                   /transl_table=1
FT                   /translation="MSTNESRNESSLAESSRVGRAQNECVTIYRPSQHREAPPPHKQQE
FT                   YITHDTLLFEEMHMGIAVVDIAKWRLVVDGMVENPFSISLPELCALPKLSVVAFHECYG
FT                   SPLRPSDRNIWRVGNVTWTGVPLKFLLNIAQPLGSARYMWSEGLDHGAFAGKKITCYQK
FT                   DVPLEKAMSDEVLVAYEVNSEPLRRERGGPVRLVVPGWFGTNSTKWLWRLSFQAQRAPG
FT                   IFASHYYNRPNPQGGIQPVWEVEPNSMIIDPSPNAKVVGPRVMIRGWAWSWDGIEAVQI
FT                   RQSGKSEWQQAETKPRQDFSWQAFRHFIVLPKGRCSVVAQAISRSGKMQPLENQRNCAH
FT                   NVDFEVIVESEGRIHQITDSL"
FT   CDS_pept        complement(451974..452741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949817"
FT                   /orf_name="Pc13g01950"
FT                   /product="Pc13g01950 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP91264.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000183090A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B5"
FT                   /transl_table=1
FT                   /translation="MFLPPVHAETEIAVLFQFIRENPLGMLITGIKSSQEFLQCTHAPF
FT                   VLDLPEETTGSPLQGRLRAHIAKQNPQVKAMIEELVTKPNILELEDNVLVVFNGKYNHY
FT                   VTPKYYVETKPDTGKVVPTWNYSAVQVYGKLSLYYDSKTPEAGAFLAKQMDDLSQHAEK
FT                   SVMGHMGGEKPQPWKVSDAPEKYIELMQRNIVGIEIRIEKVQGKFKMSQEMKPGDREGV
FT                   VAGFTRMGGENAEGMANLVEERGALHDSRAQSG"
FT   CDS_pept        join(453284..453655,453721..453787,453950..454134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949818"
FT                   /orf_name="Pc13g01960"
FT                   /product="Pc13g01960 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91265.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="UniParc:UPI000183090B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B6"
FT                   /transl_table=1
FT                   /translation="MSRPTPLRIAVLINTPSDDYDFWTDVRQAWQESFAKVAPNAEVDF
FT                   YDPVFERAFPDASKYDLIALSGGKADASSSDPWVLGVLDFVRTVVRDHPKTKILGVCWG
FT                   HQAVARALGGEVGAVPTGPIAAIQDIALTDAGKKFLTFATSAVLSFQAHPEISNRLAKK
FT                   MLLADDKEYNGNSTAEQLKAEVQKLDQPTDGVKLLKRVIQWLDE"
FT   CDS_pept        join(complement(456868..456957),complement(455215..456816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949819"
FT                   /orf_name="Pc13g01970"
FT                   /product="Pc13g01970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91266.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183090C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B7"
FT                   /transl_table=1
FT                   /translation="MYEPAPPRPKKTDIVRSRNGCQSCRKRRTKCDEKKPVCGTCVRLG
FT                   IVCESVKLDLKFRVVTAPPPKKTGAKAEPAEPDSTRLGLQLFGQHSRSPQIPNINLAQS
FT                   LQHTDRDVFYSTYWEDHCLPALHPIFRCASELLGFPALKDAILALSSCNISRIYAERKY
FT                   STSFPTTGTLSPNLIHQTRSQLYYSSAIKKFISLTQDDHRNNAAEVLTILVLFGYIEAS
FT                   MGNFDGYYCHVQGLSAFLVELRETTGYSLYRALLISWLQSQFLIWWARTYFSSLDVQRN
FT                   MPSIDFPRGLEGTSDSFHDLRVVVLSILCESHRLNVKETLKHWRDKTDFEPALASVLQS
FT                   DRDDTEDRFARLQDESKRLDEWLSYLPPSEQPLVGDASETSPIFFQAHDAALNFAYYVV
FT                   ARIMQCISFLRNLPCRDAQHLGSECLEIEPWARLLLRIVQGTDMQTSIIRNNYTIGFSG
FT                   LLLAASLRCQDLSLSMQIEKWLQTLEEKQPTEEGAFPVYQALAVVKAINRQRTMGRDVF
FT                   GVSQTMDDGGGMPKFTHYNSQMITNILVHGKCRSTGDLFTECIDLQ"
FT   CDS_pept        join(459027..459171,459222..459398,459454..460057,
FT                   460107..460692)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129226"
FT                   /orf_name="Pc13g01980"
FT                   /product="Pc13g01980 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91267.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183090D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B8"
FT                   /transl_table=1
FT                   /translation="MSRLSFPQKSSEAVSNNVATAKDLELLVQDQAFIDGCWVKRKQTF
FT                   NVYEPSTAQVLGTVADCDLNDIQSAIESANVAQKNFYSSTTAAQRGNLLRKWHDLVMQN
FT                   IEDLGRILCLENGKTINEAKGEIAYAASFIAWFAEEATRSYGDTIPSSTPNTIVMTEKE
FT                   PVGVCGIVTPWNFPAAMITRKVAPALAAGCAVVIKPPSETPFTCLALTKLALKAEIPGK
FT                   AIQVCPTKNRQVASELATHPLVRKISFTGSTNVGKNLAILAAGTLKRISLELGGNAPFI
FT                   VFDDADVDLAVEGAMMSKFPCSGQTCVCANRLYVQRGILDKFTRSLVQKVSELRLGPGI
FT                   EDSCTQGPLINASAVNKVKNHIEDAVSKGASVEIGGSAPEAPGFFMQPTVLSGVTVDML
FT                   VARDETFGPLAPIFPFDTEEEVLQLANSTEFGLAGYIFSGNVARVMRVARKLEIGMCGV
FT                   NTGKISAAESPFGGVKESGYGLEGSKYGMAEYQTIKTITLGNLHM"
FT   CDS_pept        461140..462651
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129227"
FT                   /orf_name="Pc13g01990"
FT                   /product="Pc13g01990 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91268.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183090E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B9"
FT                   /transl_table=1
FT                   /translation="MSFELEGTKLSLGVAFTTSCGFLLFGYDQGVFGGLIENGSFQSTF
FT                   RQPSQMVIGQIAATYDLGCFFGAIFCMVYGDRIGRRLSIALGCIVLTIGAVIQTVSFSV
FT                   AQIIVGRFIAGLGNGLNTTAIPVWQSEMSKPQHRGRLAVFHLVLNQLGNVTAQWLNFGL
FT                   GYIGHQQVSWRFPIAFQIFYALVTLVLLPWLPDSSRWLIQKGRLEQAKAVTARLHAKGI
FT                   HDPDLLALHEASVQSVQHELEVSKVSWRTLLQRDSLQTRRRVLLGMGTQFMQQWGGINA
FT                   INYYLPVVFASLQVSRQMSLILSACNAINVMVFTAVALTTIEKVGRKRLMLWGAVGQGT
FT                   CFALLTSGLGVGGSQWSAVAIAFVFAYYTVFGMSWIAVPWMYPAEINTQAWRNRGAGLA
FT                   TATNWICNYAVVLVTPIGIENIDWRYYIIYVVLNFSFVPIVSFWYVETAGLSLEEIDKI
FT                   FEGKTYGIPLDVSEGGATTENEEGKARQDEVNSEWIEAVDSSKRD"
FT   CDS_pept        join(462938..463012,463078..463160,463216..463559,
FT                   463644..464103,464154..464362,464416..464548,
FT                   464605..464829,464890..465045,465097..465772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129228"
FT                   /orf_name="Pc13g02000"
FT                   /product="Pc13g02000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91269.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183090F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C0"
FT                   /transl_table=1
FT                   /translation="MPQTKTVKPARKHVTTACIPCRDGKCDGSKPSCKNCESKNKDCTY
FT                   RQRNDKRKIPVRVAVSLLASRVAVLSQHIQNAGFGVPAMDKNDRDTLRGILQSLGIACE
FT                   NVLSDENTSHSAGASFPGSQRPVDTTRFVAHDQTNITSPQPPAPGCDNYHPGGDLPPLH
FT                   ERSAGPSQLSESYRMHVVTPTQFPPNVDVIPSENPETDSEDEVTDQFACRLGRVQLTHD
FT                   GQLRYFGSTSNLNLLDVSDDIRNFTSSLFQKDAQDTLEDLGLNIEVEEAFEKHLLQLYF
FT                   AWQDPCLHVVDSEAFWKAKNQNRYEGLTSAYYSQALCDAMCAMGAAYEPKYHPDLVTFP
FT                   RSLSQFFGDRAKALLELEIENPSLATIQALVICSNYEASGTRDTRGWLYSGMAMRLAFD
FT                   QGLHLDVTPYVEKGIITAEECKIRRTVFWSSSLNDQFWGYYLGRSVRSPVAGVSVRKPC
FT                   WNDRSPMSQQAPRWRSYGCSQVNIQGIANPSDMIFQQWIALYDLMSPVTDVLYGCLEIS
FT                   RTALQELTADTVARLLAWKNNLPNDLNVDATKESYYYLPHVLTLHLQYYQFMIHCHRPY
FT                   ISKNHIQPRPLQGPGPGHARRMCLESAISIVKVLNMYERRYSFRKANVQMVSYVFSAAL
FT                   ILMFVTVPGQSSTQHSDLVRYLSTCFWALDEMGTCFENAKRTSRFLSTLQQQWHKRKRG
FT                   MAQKGAKRGPENENSPGKHPKRSRNTAGTQNWLGDNLCSSAELGVPVAVDSPISHETHD
FT                   LSFFGDNGPDLVEFMDPELCNILLSDGIPRAMN"
FT   CDS_pept        join(complement(468008..468200),complement(467635..467952),
FT                   complement(466749..467578),complement(466612..466684),
FT                   complement(465931..466562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949820"
FT                   /orf_name="Pc13g02010"
FT                   /product="Pc13g02010 protein"
FT                   /function="transketolase activity"
FT                   /protein_id="CAP91270.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI0001830910"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C1"
FT                   /transl_table=1
FT                   /translation="MPDDEHAVLTLRNLIFDICNQNGGGHGGSAVGMAAIGVALWKHIM
FT                   RYNPSNPDWFDRDRFVLSNGHCAMFLYALNYLTGFNAWTMNELKGYGGGKENGFTTIAH
FT                   GHPEIECPGIEVTTGPLGQGIANSVGLAIASKNLAARFNRPGYEVVSSRVYCMTGDGCL
FT                   MEGVALEAISLAGHLQLDNLVLVYDNNGVTCDGPLSWINTEDINQKMRASGWHVLDVMD
FT                   GCDNVQAICSSLRRAQSLKGKPTFINIRTVIGVGTTTAGTAKAHHGSFDVESVAKSKLA
FT                   IGQDPYQSHKPTARGLDYFRERKQHGEALEKSWQHLLMQYTLDFPDLASDFASRLRGAK
FT                   PDLGSLLQDLDSSQFSQMPTRESNGLILQKLWETCPSFCGGGADLVNSNKFFYSDTDVF
FT                   HPSVSYQGRYIRYGIREHAMASISNGLAAYHPGTFLPVTATFLMFYIYAAPGVRMGALS
FT                   HLPTIHIATHDSFAEGQNGPTHQPVELDSLYRAMPNLTYIRPSDAEEVIGAWMWAVESA
FT                   SSPTMISVGRDPVDQPAITSRFNVSKGAYVLEEHPDAQLTLVSCGTSLHYAIRAANELS
FT                   EQLSIRCRIVSAPSFDLFDQQPAEYRESVFPLDGNPIISVEEYVATTWARYVTASVGMT
FT                   SYGYSASNPSNYERFGLDTRGIVLRVKRYLAFLNGRSARQMGWRSI"
FT   CDS_pept        join(complement(469641..470083),complement(469174..469585),
FT                   complement(468820..469122))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949821"
FT                   /orf_name="Pc13g02020"
FT                   /product="Pc13g02020 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91271.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C2"
FT                   /transl_table=1
FT                   /translation="MTVSPRTSKGQYLHGPQQLRLEERPMPSIGPSDVRIRVRSTTLCG
FT                   SDMHYFKFGRNGSIEVKEPLCGGHEAAGEVVEVGATALETGKFKVGDSVAIESGVACLE
FT                   CDRCKAGRYNICAQMRFRSSGASFPHFQGTLQEFVDHPAEWCHKLSRTLSFDDGALLEP
FT                   LSVCVHSVNRAGMKQGARCLVLGAGAVGLLCAAVAKIEHRSPVVIADVDKGRVAFALEH
FT                   GFADVGFVVDPKKGDTVESRLSVAKDLALQIGNQKWPGGEEVRQVDHVFECTGVESCVQ
FT                   TSIYATTNGGNVVLVGMGTAIQTWPIAELTGREINVVSVWRYVNCYPRAIEIMEGVRAN
FT                   SLKPDVTKLITHQFVGLDSIPSAYDTAGKTRDGESKLVIKTVVNF"
FT   CDS_pept        join(470395..470499,470553..470611,470667..470761,
FT                   470830..471113,471176..471283,471353..471584,
FT                   471637..471934,471983..472490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672163"
FT                   /orf_name="Pc13g02030"
FT                   /product="Pc13g02030 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91272.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018309E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C3"
FT                   /transl_table=1
FT                   /translation="MASSYAPTAIIIGAGPGGISMAYRLKHELGFNDFLIYEKLDGVGG
FT                   TWRSNTYPGCGCDLPSHLYSFSFNLNANWSKELCEQPEILQYIEDTVDKFDLRQHVVTS
FT                   VECLGGAWNPDEKEWTVKFRDVETGLEFERHATVFVSAVGAISFPRDVRFKGMENFKGD
FT                   MFHTARWDHSVDYTGKRVAVIGNGCSAAQVVPAVSGKAAFVQQYARSAQWYHPRPNKSF
FT                   SQLEKWSFRWLPLWQRWLRLRIFLTAEQEAYTYFSSEAGIKARLAAEDESREYILSRTP
FT                   QQYKKAVVPDFPLGCKRRIFDPGYLDSLHQSNVKLCNEGIQEFTENGIIGSSGIEDEFD
FT                   IVVLATGFQVSQFLAPMEIYGRHGVSLNKQWSESRGAQAYYGTFVHNFPNLAIIFGPNT
FT                   FPANNSALFACETQVCFAVKALFEPILDRRARVVEVKQSAEERHTISLQEQLKGTVFAG
FT                   DCSNWYINEFGRNAASWPARAAFLWLETFWPNWKAFLWKDGSATWPLYRLARWWKMGSW
FT                   CSKASIAAIVAIFLSHNRAGSTLGVTGAFETLHERIRALTCYLAI"
FT   CDS_pept        join(472872..473198,473252..473992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978064"
FT                   /orf_name="Pc13g02040"
FT                   /product="Pc13g02040 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C4"
FT                   /transl_table=1
FT                   /translation="MTKVKANIGVVGLGRMGQRHALNILHQVPRAKLFAVCTPASHEIE
FT                   WAKAKLVPDGVLVFQSFEEMIHTPGLDAVVIASPTELHIAQTLTAMQLEIHVLCEKPIT
FT                   RDIPQLRDLMETAKQHPQTKVMVGFVRRFDENYMDAIQKIKSGAIGEPLIVRSQGAEKL
FT                   DKSGFFIEYARQSGGIFVDTVVHDIDLTLSILGEEVRPKALWATGIIAHHHEMKDFKDV
FT                   DNSVGVVEFWGGRIAHYYHSRTTSHGYDNCTDIIGMNGKISINSVPHSNRVQVSNASGI
FT                   MQDCTPSWIDRYREAFVTEVNQFTDAILDNTELPMRLSAAYTGLKIATAFQESLETGRK
FT                   IEFDENGDRIVSNGK"
FT   CDS_pept        join(complement(475405..475471),complement(475207..475351),
FT                   complement(475078..475155),complement(474932..475013),
FT                   complement(474660..474883),complement(474394..474610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949822"
FT                   /orf_name="Pc13g02050"
FT                   /product="Pc13g02050 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91274.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018309E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5"
FT                   /transl_table=1
FT                   /translation="MANLASSLAARFSLGGRVILITGGGRGIGMALSKTCLDAGATVVV
FT                   TDVLPQPDPVFLDWRKSTPDQLHYYCCDLTNKEEVGRTFTSILEKFHHIHGVVTAAGIC
FT                   IDKPFLKHEWEDIQNLQAVNETGTFFAVQNVVKNMKQYGIKGSIVMICSQSAQHVCPGH
FT                   LLTAYAGSKGFVFSMARSLAHELAPDGIRVNTVSPGYIATDMNLSLASLRPELLKIFCE
FT                   APPLRRVGTPQDVELAVLYLLSGGSSYVTGQDLAIDGGMQVSSGNYKL"
FT   mat_peptide     join(complement(475207..475337),complement(475078..475155),
FT                   complement(474932..475013),complement(474660..474883),
FT                   complement(474397..474610))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5 "
FT   sig_peptide     join(complement(475405..475471),complement(475338..475351))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5 "
FT   CDS_pept        join(complement(476694..476973),complement(475746..476632))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949823"
FT                   /orf_name="Pc13g02060"
FT                   /product="Pc13g02060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91275.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C6"
FT                   /transl_table=1
FT                   /translation="MTQTGKHALIFGASGISGWSLLNQTLQYPTPTTFNRVTGLCNRPW
FT                   ISEDAYLPDDNRLNIVSGIDLTQSVEAVKAQLKEKVAKVESVDVVFFCAYIQTGDFQSL
FT                   RKVNTDLLQTAIKAISAVSPTMEAVILQTGGKGYGLEFPKEVTIQPPLHEKMPRIPSPW
FT                   RENVFYYDQYDLLKRLSEDQNWTFTEIRPDGIVGFAPGSNVMNMAYGIAFYLTLYREVN
FT                   GKDAKVPFPGRLHGYHTRHTDTFQDILSKMEIFAALNRGKCQNGSSFNCGDGEAVTWAQ
FT                   VWPGICSYFGLNGVEPDGMQKNMQDFVSENKAIWDRLVLTHDLKKGLIESQNWGHTNFM
FT                   LVDFDFAREYSLEAARSVGFNEQIDTLQGYHVTFDRMVNARFIPVPSS"
FT   CDS_pept        join(478622..478821,478879..479223,479283..479481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824871"
FT                   /orf_name="Pc13g02070"
FT                   /product="Pc13g02070 protein"
FT                   /protein_id="CAP91276.1"
FT                   /db_xref="UniParc:UPI00018309E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C7"
FT                   /transl_table=1
FT                   /translation="MSDFWLTEHIRHLVVQPADARLNPPEGYLFVQDGFIISCGVIYAL
FT                   LYVFVMIRAVKDRVLPGTIKYLSLTLAYELYYAFATTSTRLERICFLAWFELDLTFVAL
FT                   ALWRVYRPDQRKRIAGEMFIYCITALAGLRYLGYLYPDDREQITAYWTGILLQLPVGWV
FT                   YVYGLVKHRSLLGHSLEIWLLRYLGCFTAYGLFIWRYLNVPRNWEYVGSFWSIATIVTT
FT                   LIPETVYPFLYIWVFNQNRNKVKMG"
FT   CDS_pept        join(480553..480791,480978..481170)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129229"
FT                   /orf_name="Pc13g02080"
FT                   /product="Putative uncharacterized protein Pc13g02080 "
FT                   /protein_id="CAP91277.1"
FT                   /db_xref="UniParc:UPI00018309E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C8"
FT                   /transl_table=1
FT                   /translation="MPSTTPKDLTMQTRDFHLPPARAPPSLQPLHHLSQRLLPNPSDLI
FT                   VHGAISAFNNEALLSPSPKQTWLQTGEDANSLIARSIKGPGESAEIVFLVTKNGTWMQY
FT                   NPNYAGNVSHALRIVAMTAFQEQRRLSTCSVSATRNSWR"
FT   CDS_pept        complement(481456..482402)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(483308..483720),complement(482809..483222))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949824"
FT                   /orf_name="Pc13g02100"
FT                   /product="Pc13g02100 protein"
FT                   /protein_id="CAP91279.1"
FT                   /db_xref="UniParc:UPI00018309E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C9"
FT                   /transl_table=1
FT                   /translation="KLEVNANYYPLPIYRKLYIXSRYESKAXLYIAPRISSDTSIPYVD
FT                   AKDIILHLKTIFANLNRRIEAYTAYYKLKIKPKDSFTNFLIEFIXLAEEAIVITENYKR
FT                   NLYSKLPYLLXSXVIXVVNXDTILFDIFTQIYXSIAHEISLXXEVKTSSRTRSTIPATG
FT                   AGGISAANXLNTPRVKREYTLSLSTSERETLIREGXYFNYKEYRYITYNYPKKKPTLAI
FT                   ATTTPTINPPRIDEIIELKANTDSGKVPT"
FT   mat_peptide     join(complement(483308..483648),complement(482883..483222))
FT   sig_peptide     complement(483649..483720)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C9 "
FT   CDS_pept        join(complement(485581..485714),complement(485406..485532),
FT                   complement(485337..485349),complement(484774..485273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672164"
FT                   /orf_name="Pc13g02110"
FT                   /product="Pc13g02110 protein"
FT                   /protein_id="CAP91280.1"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI00018309E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D0"
FT                   /transl_table=1
FT                   /translation="MPKKKGCAAKIVKKPSWIPVSPDLSRDRVIQNNLPGKELLYALAS
FT                   LRLHSKYSDISLTCGNTIYTVYKCIVCTRSEFFAKACSSGFKESSIDYRVKGCLSGSSH
FT                   DILEETSTVNDSGSPTVFTAKPIPYIAESGADEDSLGRPVEPIEDLIAEIDPLSFHILI
FT                   YSLADRMFIVGLEAISKAKVERELLRRLDANTFQSAIVEIYNSTPASDRGLRDLAVEIT
FT                   LYHLRELRTSKERADFAFPSWRDPCHNLRLICLPQ"
FT   CDS_pept        486089..486868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949825"
FT                   /orf_name="Pc13g02120"
FT                   /product="Pc13g02120 protein"
FT                   /protein_id="CAP91281.1"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniParc:UPI00018309EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I0"
FT                   /transl_table=1
FT                   /translation="MAGDTIPKLAVLIDADNARPSVVNLLLSEIAKYGTAHAKRAHGDW
FT                   TRSSLQGWKDVLLEQSIQPIQQFAYTHGKNATDSAMIIDAMDLLYSNRYDGFCLVSSDS
FT                   DFTRLAARIRESGLIVYGFGEQKTPKPFVAACDKFIYTENLVHLDELVPHTNSVMIPGN
FT                   HVPTLQAQNDSRLRNQLRTTVEAASDDDGWARLSSVGQLLTKKYPDFDSRSYGYHKLSD
FT                   LIAASSWFETTRRSLRNGLSPEIFVRDKRRKSKALAD"
FT   CDS_pept        join(488391..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490975)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949826"
FT                   /orf_name="Pc13g02130"
FT                   /product="Pc13g02130 protein"
FT                   /protein_id="CAP91282.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018309EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1"
FT                   /transl_table=1
FT                   /translation="MWPLSPLLLLSLAAGSFVRLSSYPLAVKTPYLPAWLPGDQAKNVS
FT                   TARPEFWAGQPLTWKVITRVNGEVYSLFGCPDENITSVDQISISYSATHTVVTLKTGNN
FT                   NNIEGEVDVMTAIDESWSAQPGQMVMGCAAPSTILSQFPLFGQVSRNISNYTRDDLVAF
FT                   AYRFGCRNVVQTSSVTFAIGLQQDLNGFFGEVYESLYFEPLWSTTEEVVDHFLEDEACA
FT                   REESKKLDQQLIIFCSWLISSSWGLIHISVPWCSKDTSYHLGFMKAISASGRVSPISGL
FT                   LPSALPAFYVLAPDYIPLLLKPVLNMTLGWPMDYALHDIGKHYPNATGPTENDEYTFPL
FT                   QQTSTLLWMVYAYQKPSGDIEWAKPFLPALHRYADYLVRHGQYPPEERSTIDHNESRAN
FT                   QTLIAISASIGLKAYGALSGMANYTDIGNLYASTIMDLGTDTKQAHFTSHYGRADSSWI
FT                   TSYPLAYDKLLGLDTFDEAVYEMQSTWYKDLIQPDGLQFSSDVQFTVADLEMMAAATCS
FT                   NDVQALIVDSLHQTTTSRIDSVPGPTRWNVTGANSGRQSSTKAQAAVGGYWMLAAVNMS
FT                   GQGVPVELPSELWLTQDIYQVPLKPSQVSLTKVRIPELIAQGHKGQTQKNGTAVRPGAQ
FT                   QPEGSKDIQEVVTASKLIHIDL"
FT   sig_peptide     488391..488456
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1 "
FT   mat_peptide     join(488457..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490972)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1 "
FT   CDS_pept        join(complement(492493..493149),complement(492423..492448),
FT                   complement(491427..492373),complement(491195..491359))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949827"
FT                   /orf_name="Pc13g02140"
FT                   /product="Pc13g02140 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91283.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI00018309EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I2"
FT                   /transl_table=1
FT                   /translation="EVRKKRNPIGGIEIFTTSLSEIDRILTIKSSIEEDLKLREIKKIL
FT                   PLEYHDLAEVFSKKKLDKLPLYRPGVDHDIILKAEAXPGYYPLYKLSLNKLKAAKXYII
FT                   KNLDKGFIILSASPYISLILIVKKPSGRLRFYINFRKLNIITKKDYYPLPLIDKVLXRT
FT                   SKAKYFTKLNIRXGFYRIRLTLGAEDLTTFRTRYGSFKYKVILFGLTNGPAIFXRFINN
FT                   ILREYIDKYIVTFI"
FT   CDS_pept        complement(493631..493987)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        494415..495099
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        495404..498367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949828"
FT                   /orf_name="Pc13g02170"
FT                   /product="Pc13g02170 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91286.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00018309ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I3"
FT                   /transl_table=1
FT                   /translation="MATRKARNPLAFMPWPVTILTTAMYLALIIPLLVIHHNVPPAPRT
FT                   SPNGLNLTEAWQDLQSLTKGFHPYNSHQNDEVRSWLLERIDAIKQSTPSTEEYRDAKEE
FT                   KPDVFVFDDLVSNLTFIDKSVGVYFEGTNILVYIRGSEDNKQNWWETPGRAPVGKGGVL
FT                   VNAHYDSVSTGYGATDDGVGVVTCLQLVKYFLTPGHAPRRGLVVLFNNGEEDYLNGARV
FT                   YSQHPMARFAHTFLNLEGAGAGGRATLFRSSDTEVTQAYAKSEHPFGSVLSANGFEKGL
FT                   ISSQTDYVVLEGILGLRGLDVAFFEPRARYHTDQDDARHTSIDSLWHMLSTAVATTEEL
FT                   VSDTTDRFDGHIRDDGTVPSGSGTRAVWFDLFGSAFAVFRLHTLFALSVTLLIVAPLTL
FT                   LVTSVILSRADKMYLFRSSVYSEINDDYIPLRGLRGFFRFPFLISIPTGVTVGLAYMVT
FT                   KVNPFIAHSSSYAVWSMMISAWIFLAWFVSRVANSARPSAFHRVYTWTWMFVLTWSLMV
FT                   VCTVYEHEEGLAGGYFIFFYFAGTFLATWISYLELFALPTKSEYVGRLAESRRPSTQGS
FT                   RLAASGDEHQDDAAEEDPTESTSLLHGRHRPTFANYVRVGVDRASQDEEEEEEDPNVYE
FT                   HEQGWSGVLPRWTWLLQLLITAPVILMLIVPLALLTTSALSQTGQDGSPQLLIYLFISC
FT                   LTALLFAPMLPFIHRYTYHLPIFLLFVFIGTMIYNLVAFPFADSNRLKLFFLQEVDLDN
FT                   GISTASLTGMPPFVSDVTYGLPSAAGQNESCDWTFRGKRKLQRCSWSAPLPHVVPDGDS
FT                   LSVSSEDADSLLDATELSPDWISFSISHPQRDSSSVRFEVSGQNTRNCRINMDGNSITN
FT                   FSVIGSSAPDHRFLNPSPDGLNRIQLWSRTWDNKWTVDVDFSKHDSSETDEVDESSITG
FT                   RITCLWSDNNRVGLIPALDEVRQFSPAWVAVTKFSDGLIEGSRAFEIKRSSLGALGS"
FT   CDS_pept        complement(499214..500314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672165"
FT                   /orf_name="Pc13g02180"
FT                   /product="Pc13g02180 protein"
FT                   /protein_id="CAP91287.1"
FT                   /db_xref="UniParc:UPI00018309EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I4"
FT                   /transl_table=1
FT                   /translation="MGDFTAPGNGISGHYQGTSLGMKITIATLAGVTWYNAFELMILLF
FT                   VTFAEYRGLYFWSLFISSSVGLLPYSLGFLLKFFKITDDIAWFPVTLLTIGWWSMVTGQ
FT                   SIVLYSRLHLVVSNQRVLRRVLIMIVVNAIILHLPTTALTYGTNMADDTTLWTKTYNIM
FT                   EKIQMTGFCIQEFIISGLYIWETVRMLRLDPDRIKRKIQYQLLAINLIIIILDLGLLVA
FT                   EYLDFYIMETMLKGVVYSIKLKLEFAVLGKLIHLVHNHVWKPESFSAPRDLPDFVDATR
FT                   VTSDMTHATHSAIQRRPSRMDADDISIAMFEHLPPDRIRTNSDLSHSWSNEGRAYHVDH
FT                   LPIDFTNPFAHYPRYQSRRGIPEKPG"
FT   CDS_pept        complement(501217..502122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949829"
FT                   /orf_name="Pc13g02190"
FT                   /product="Pc13g02190 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91288.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I5"
FT                   /transl_table=1
FT                   /translation="MGKRIVITGGSGKAGQHIIRYLLQQGHDLLNLDLVPLPAELEERV
FT                   HTLRVDLTNTGQVYSALGSHFHLSEPFREPLGLVPDAVIHMAGYSRNMIVPDEETFRSN
FT                   TSAMYNIIEGASRLGIKKIIIASSITVYGVSYAEGDVDYPSFPVDETVDANPMDTYAIS
FT                   KVCGESIARGFARRYGRDIYILRIGRIVAPEEYKQSMFRSYVENPEKWAPHGWAYIDAR
FT                   DLGQMCDRAVQKDGLGFQIFNAVNDGITNYENTAEFLARVCPGVPVTRELGAREAPICN
FT                   RKIKELLGFREEHHWMKYYE"
FT   CDS_pept        complement(503512..504276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824872"
FT                   /orf_name="Pc13g02200"
FT                   /product="Pc13g02200 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91289.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I6"
FT                   /transl_table=1
FT                   /translation="MESPKKLKIASLGSSFAAGPDIPPQIEPRAALRSGQNYPHLLAQH
FT                   LNADLTDLSVSGATLLNITVEPQATPFNVTFPPQSSDLPEDANIITVTAGGNDINYIGG
FT                   MIADACDAELQSSVSLSPSELAERLGGVLDQIHKRAPGARIFLVEYLAVLGPGTQAGRD
FT                   IPLTQERIQYHRGVADVLQHAYSVAVQGRTDWCETVPIHQLSQEHALGSKEPWVGGFES
FT                   GPLLHPNLDGMKAVADILAETIRKSTLSKALL"
FT   CDS_pept        505248..505661
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949830"
FT                   /orf_name="Pc13g02210"
FT                   /product="Pc13g02210 protein"
FT                   /protein_id="CAP91290.1"
FT                   /db_xref="UniParc:UPI00018309F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7"
FT                   /transl_table=1
FT                   /translation="MQISQFLLATGLFASSILAAPITSSDWTILDMKRVCNGENTSCTW
FT                   TFGIDSGLDITDCTFIVEATDASHANGGPSTCGAYTVSSGWSGEFDPTNGFTTLSVANE
FT                   EIGQIIWPAYTDEQLADGDVVKPDQSYPPTAFP"
FT   sig_peptide     505248..505304
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7 "
FT   mat_peptide     505305..505658
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7 "
FT   CDS_pept        complement(505971..506774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949831"
FT                   /orf_name="Pc13g02220"
FT                   /product="Pc13g02220 protein"
FT                   /function="proline racemase activity"
FT                   /protein_id="CAP91291.1"
FT                   /db_xref="GO:0018112"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniParc:UPI00018309F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I8"
FT                   /transl_table=1
FT                   /translation="MESEEYAPMSGSNTICTATVLLETGMVPMKEPITQLTLDTAAGLV
FT                   TVEAKCEGGKCKSVAFDNVPAFVFELDYQVLVPGLGEVSVDIAWGGMMYVLVAAASVGL
FT                   KVESRYSTQLVEIGERIKRAVQATYTPVHPVNPKIKGVSILAFTEPLVEENGCKAAVNT
FT                   VVVSPGRFDRSPCGTGTCARLAVLHARGQLAEGEVFKHRSIIGTEFTSHIRGTTRVGGY
FT                   KAVLPTVAGRAWITSFKQVVLDSSDPFPEGFRVGDQWQMAPSSLL"
FT   CDS_pept        join(complement(508757..508917),complement(508550..508581),
FT                   complement(507640..508502))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949832"
FT                   /orf_name="Pc13g02230"
FT                   /product="Pc13g02230 protein"
FT                   /protein_id="CAP91292.1"
FT                   /db_xref="UniParc:UPI0001830AC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I9"
FT                   /transl_table=1
FT                   /translation="MQEQKSQSCADLLILPRNKGDAGDWRQTRRTNFHLDDPNNLSDII
FT                   PGWSNICIITRNSGVETGFNTWSRFSVKKVDHDARFKWYHPNIFTRWLPLTKQTIILAF
FT                   DLDPPIKERFLKSVMKSEESWLNDPFWVYPHLVEQIALIQEPAVWAIRDHVRSMETEGK
FT                   PQGRPQPDYRRLHDIARHAIHVNETLDIAVQNIEHILTQHASYTKSKPDNTSPASEDIH
FT                   LRLGSWQSFIANLRSRSIANEKRLQNEIQLAFNTVAQHDASVTLEIGRATQLDSATMKT
FT                   IAFVTLTFLPPTFICAIFSTSFFDFGGDSGWSMSNKFWVYWVFAIPTTVFTTLVWTYWP
FT                   NIRRIFFSKNE"
FT   CDS_pept        join(complement(510290..510925),complement(510042..510241),
FT                   complement(509382..509956),complement(509129..509322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978065"
FT                   /orf_name="Pc13g02240"
FT                   /product="Pc13g02240 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91293.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J0"
FT                   /transl_table=1
FT                   /translation="MADEVTAPQQHSSKNKGSEPHPPGQFPSVEEGKQTSANGVLEALG
FT                   YEPELVRNRSTLQVAFMSFVLAAIPYGLATTFTYPLIGGGPVNIIWGWLAVSLITLCVA
FT                   ASLGEITSVYPTAGGVYYQTFMLSPPSYRRIASWICGWSYVVGNITITLAVNLGSTLFF
FT                   VSCINVFESAPGVGIFQATTYQVFLIFLAVTFLANAISAFGNKWLPYLDTFAIFWTLAG
FT                   VLAIVICILAIAKEGRHDAEYVFTSFEPASGWPAGWSFCVGLLQAAYTTSSTGMVICMC
FT                   EEVREPSTQVPKAMVGTVILNTLAGFLFLVPLVFVLPDTKVLAALESGQPVPSIIKSAI
FT                   GSPVGSFLLLLPLILLSLFCVIGCTTAVSRSTWAFARDGGIPGSVWWRQVNRDGVPFNA
FT                   MMLGMTVQILLGFIYFGSTTAFNAFTGVGVITLTVSYVCPIVVSLAGGRRHIKNGQFDL
FT                   GTLGLVCNIVALGWCILVIPLFCMPSSIPVAANTVNYAPVVFVAFILVASGWYWVWGYE
FT                   KYVGPPTMDDEFRSSAW"
FT   CDS_pept        complement(513181..514125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824873"
FT                   /orf_name="Pc13g02250"
FT                   /product="Pc13g02250 protein"
FT                   /protein_id="CAP91294.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J1"
FT                   /transl_table=1
FT                   /translation="MACLVKTMRDPPRESIAQVDGDANTWLIGPLQLHCRKGSSGTFTW
FT                   YDEDDNLSYTLTDAPDPLPPTIPLDDPRFKLVYDAGDSSAVWSVGNSAFCKVKLCRQGV
FT                   TSEAATLKFVQKLVYEQQPDFKIPKVLHQTEHNDRSYLFLTRVQGRTLGDAWPTLDEKW
FT                   RQHYIKAIVNVCKFLESQECDKLCGADGKNALELYLIKYGAEKDYSPDNLRQGCILIGM
FT                   DCSKFVFYHADLGPRNIIVEDIPKTGTVGIIDWELAGYFPRGWIRTKFRISSGLNLPDT
FT                   ATDKPTAWRSGVQELLGEDGFEHYAPEWLSWWD"
FT   CDS_pept        join(515497..515601,515684..517471)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949833"
FT                   /orf_name="Pc13g02260"
FT                   /product="Pc13g02260 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91295.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J2"
FT                   /transl_table=1
FT                   /translation="MENTKELPSPQKKRQNPNRCRPKSRGGCQRCKQRRRRCDEAKPSC
FT                   QECTKRGHTCPGYQKQSLQWRYVFKGSEEAHQPVPPIGSPSTIATESFEVNNSTEQGKD
FT                   NIQDETHNIWDTACPNLFDQLPNFDGPTDAWFYTESTSNGTALGKPDGEVDGLSILRQR
FT                   LAHTSVPSFLIQLPVMLVQYYFHTVCNQWSSFDCPLNPFRTIISRLWSRNAAIYFAIQS
FT                   MSAASLANDFPTMRAIGIQTQQQAIACLNNSVQKGSTQTKDDEYFLALLMIGSTTAWHD
FT                   ASDLGLPYLRAAQDHLLRQERQYKNADSALAKQHPLFKQCLLWWNLLAAFVTEDSPIVD
FT                   VESSIENSETDLAVYLVDGQILPHPWTGSLRYSLSLFYRTARIIRAAKTSHRRRPEALD
FT                   PTLIDLTSMAEELELRQEAENLEDKILFTGFSFYCGPIDIGDSNTPPSHFLTLAEVYRC
FT                   TALLQIYHVFPEILEERLQSNQAADDESPIPALFLVLFPVAAEWSSCSVEDARHTLALH
FT                   IVSLLEQLPSTSGTKVMQPVVLACISSDLVFSSGSVLGAIENAIPSLNTLDVDIAQARR
FT                   KVKMRLSELTIILPKLPMQRIYNVVHETWDRADSGLEEFWLDVMVDLNLETIMG"
FT   CDS_pept        join(complement(519177..519236),complement(519051..519129),
FT                   complement(518782..518998),complement(518495..518735),
FT                   complement(518284..518445),complement(518074..518232))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129230"
FT                   /orf_name="Pc13g02270"
FT                   /product="Pc13g02270 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91296.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J3"
FT                   /transl_table=1
FT                   /translation="MGVSNMNQMEFQDTPAAKHPVWKRWVRFRAEDGKIYGGEPVNPDI
FT                   DVGQAIEKDVEVSVKVVTGNSALDYDAPFTGEIKTIDELLSPVSQAEAGTVRCVGLNYK
FT                   EHAAEMKLTLPNTPTVFLKASTCIASASEPIILPSNVDYDEADYEVELAIIIGRQCKNV
FT                   SVSKAGDYVLGYAVANDVTARKHQEKTSQWSYAKGMDGFCPLGPCIVSTEQIPDAARLN
FT                   LKTRLNGKIMQNGSADDMIFSIPEIVSYVSQGHTLLPGTVIITGTPCGIGISQSPPQFL
FT                   QPGDELRISISHGLGTQICPIARA"
FT   CDS_pept        join(519855..520033,520087..520111,520167..520200,
FT                   520254..520458,520516..520620,520674..521240,5
FT                   21298..521469)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949834"
FT                   /orf_name="Pc13g02280"
FT                   /product="Pc13g02280 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91297.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J4"
FT                   /transl_table=1
FT                   /translation="MDKETDIKQTDLSSDHDVQMGNFVVDPIREKRLLWKLDLCICPLV
FT                   MLIFLVAYLDRSNLGNAAVAGMPEDIGLIGNELGNAVSLFYATYVFFEIPFSMLLKKLR
FT                   PNRLISALIIGFSVSILAAGFIKNAAGLYITRLFLGVFESGLFPCLTVLLTTFYKREEQ
FT                   AQRISYLFVSAALSGGFGGLLAFGLVRLDGAGGLEGWRWLFIVEGIMSAVVGIATFFLL
FT                   PNNYETAYFLNEDDKELMRMRMQQSARYADTEEFDIKEVWKTLRDPKSWLTSFNQICVN
FT                   ICSFGFSTFLPTIIRGFGFDSVKTQLLTVPVYIWASAFYLVVANLSDRVRMRAVFMVPL
FT                   CLVTAVGYAMLLGVDVHARGPLYFATYVCVTGIYAVVGLGVSWNANSHSGYYKRAMGVG
FT                   LQQTIGNCAGLIVSGISYWHARVVALTSS"
FT   CDS_pept        join(complement(523667..523892),complement(521850..523609))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949835"
FT                   /orf_name="Pc13g02290"
FT                   /product="Pc13g02290 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91298.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830ACB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H0"
FT                   /transl_table=1
FT                   /translation="MSTNEGKRNKLALDPRPRARRGRKTTSCSQCHARKQKCNRELPCS
FT                   RCIQRGIPQLCQWAEKEKGHAMPPERVRTAADTQGTELGQLYIARGAPSFFGNSYFGHQ
FT                   VAARMIQESAPDLPPMSLLSSKDSLQSFRNDSGPFSQVWDLLGLLPRNKVTVDRLIEKF
FT                   LTEINWAIDTVHPETFRSQFAEFWGRKFGFDEIAGVDLRWLALLFIILAFSVLLDSPTI
FT                   SSPEKRKESEEASLRFYWAARRAIVISPSFHGESLDLVRAGLMVTRYLLYTRQVAESWL
FT                   TISFAMRMAQAQGMHIDGEKWGLSRKATEIRRRLWSNLYLLDKTIALALGRPYAISDHM
FT                   CLIKAPDNIWLDGLTDEESSTATAHALSYPTMSTVTLLGSGLGKIAGEIQDRCFGLYPA
FT                   SYDMVIEMDNKLVAWKEKLPSYFSVEDPDLSLDGSHTFLPWHRLYLHSAFHFARITLHR
FT                   PYLLRESITNRFSLSHEACISSASSDLKIRLQSLNYGTSENMRWTLGTHNMFNSAFILG
FT                   IIAVRRPIAPQTTAILNDLEEYCERLRKDVWLNEFGLAEVKVVELCILRTTGLARATEQ
FT                   PGEQTSMSPPEVLPGFMAQERERNSMMSTPMNIESIVADGSPSHPPGSSPDIMWPAVWE
FT                   DQNFAFPQAADLETWEQMISEIAYHT"
FT   CDS_pept        join(524533..524583,524662..526500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210416" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978066"
FT                   /orf_name="Pc13g02300"
FT                   /product="Pc13g02300 protein"
FT                   /protein_id="CAP91299.1"
FT                   /db_xref="UniParc:UPI0001830ACC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H1"
FT                   /transl_table=1
FT                   /translation="MAIRRSARLRRAQDTPEVEEMTPQPVTTPRLYSVAEGEETDSSEL
FT                   PHIQTPLAKTPSQKTPRASAQQKRASIRTPTSVTAPRPSREEMHPSKAQQSTTKQADSG
FT                   LLLGFNPIKKDANGNVVKSGISDNTPTKSKASPLTDQFGTPGFEYKFHSQETELSDEAK
FT                   QLMESVRADAARIKAQMVQENSEPKPEDRETEQCHGDRKIAMPKGKANRFSDIHMAEFR
FT                   KMDSIAGHASSFRATPGRFQPVTKSLKRSKSKAQLDEPESQNSSPSRSATKVSNLSTPT
FT                   AATAAKRVKHNQSEDTSTRHESKDRTQKVKTPRRPAGPRPRPRANVRSSLMTPTHASLA
FT                   RTTSTSIKAPNTSMIPSLKLSPAAKTIASPRTPRTDFNPRLKGKLPTIGSLKSILRRRQ
FT                   PLFSRDPAKIASGTHVAAPDFNPRSLFGGAGDVSDSAPTPSPKKHVEFTPSVKSRHQLA
FT                   VASPSPSKAPSAQHRSMAEDVVYPTLPALTPEKNSAVLTSTTPTSEFKSIRPVRKSDAG
FT                   KEPAPYEELPVVTHGIAHGIVNKKRHRNEVNDDDAPSTANSENVPPTNVQSDERSTKRF
FT                   KSNPPTPSPVKKRLTKTPVRPSGQIGTPASKQRSRGVLSMSRLNMLSKPKRQA"
FT   CDS_pept        join(complement(533442..533452),complement(533368..533385),
FT                   complement(527899..533301),complement(527539..527833))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949836"
FT                   /orf_name="Pc13g02310"
FT                   /product="Pc13g02310 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAP91300.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI0001830ACD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H2"
FT                   /transl_table=1
FT                   /translation="MASRLDRLVTLLETGSTQLIRNTAAQQLADVQKQHPDELFNLLGR
FT                   ILPYLRSKSWDTRTASAKAIGLIVSNADIHDPNEDDGLQIKSAAEEDDVEIKSEIKSEE
FT                   PIPADDFLKLDTLDIPSVLKYGKRLLGSAGKEYEYSLASMEPASRLQHQKKTLTSRLGL
FT                   EGEYLEEDLIEDIELAPKVVTPAPKHEPTIPPIPHHSSLHEASSRRPSSPSESATKEDG
FT                   GLSKRQLNQLKRKNKQNAKMGANKVRVVDLSSRRQSDIVTTPLATTPHPVKAENGDDHN
FT                   GETKPDYFSFERTEEDDDSKLVTEFKGAVAPERPHILPDIVEQGAGWPLEHMCEFLTMD
FT                   IFDSNWEVRHGAAMALREVIRVQGAAAGRLDGKSRSENDALNRRWLDDLSCRLLCVLML
FT                   DRFGDYISDNVVAPIRETVGQTLGALLSHLHPNSVRAAYRCLYRIIMQTDLGLDRPVWE
FT                   VCHGGMIGLRYLVAVRKDLLVKDSNMMDGVLEAVMKGLADYDDDVRAVSAATLVPIAEE
FT                   FVSSRTGTLGPLMNIVWDCLSNLQDDLSASTGSVMDLLAKLCTFSQVLDAMKANAADDP
FT                   EASFGKLVPRLYPFLRHTITSVRSAVLRALMTFLKLEGEGTTDWVDGKALRLIFQNLLV
FT                   ERNEGVLKLSGQVWSELLNVVEMRGSFKSEDELSGSIQPLITLTLGAFGVPRYPIPMNT
FT                   SLFIKPSGLPFSAALPAPTPSKGSPPASIPGGAETKVGRRRKSEKKEKEPPPPSAHNVD
FT                   GHMLSGDIDLVGADTMLRSKIYAAKALGALISFWDKNELSSLWPAILDGLNASASTTQL
FT                   ASAMVLEEYARQSGPESKYRSSLCDRLRPILEGERPSWYSDIACYLHVARSQCHSLLNT
FT                   FRDHAHVAPSRLPTLAVVVQGDSEAGPNAFSLADAEKIVGPDFDRLKKNLTPAQRITAT
FT                   QVLNDTRTTAQSAVEEARLMREQRDMRVLAATAGALVALRDIPKKPGHIIKGMMDSVKK
FT                   EENVELQQRSATAVAGLIEHYTAATKRGPVDKIIGNLVKYCCVDTSETPEFPHNVQLEK
FT                   SILSLRKEEDRRDHPDAAKFEREAREARIMRRGAKDALEQLAVKFGPELLEKVPNLAKL
FT                   VERPLRDALAGDELPEDITNPENELGQEIVDGLSTLRALLPKFDPGLHEWVIDLMPIIA
FT                   KGLQCRLSVIRYAAAKCFATICSVITVKGMTMLVEKVLPLINNGLDVNHRQGAIECIYH
FT                   LIHVMEDGILPYVIFLVVPVLGRMSDSDNDVRLLATTSFATLVKLVPLEAGIPDPPGFS
FT                   AELLEGRDRERKFMSQMLDVRKVEPFEIPVAIKAELRPYQQDGVNWLAFLNRYNLHGIL
FT                   CDDMGLGKTLQTICIVASDHHMRAEEFAKSQSTDSRKLPSLIVCPPSLSGHWQQEVKQY
FT                   APFLSCIAYVGPPAERTRLQPLLATTDVIVTSYDVCRNDNDILSPINFNYCVLDEGHLI
FT                   KNPKAKITSSVKKLASNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKP
FT                   IAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSEL
FT                   QKKLFEDFTKKEQKELADKVGSADRGDKEHIFQALQYMRRLCNSPALVVKEGHKQYNEV
FT                   QSFLSAKRSNIRDVSHAPKLNALKDLLVDCGIGLDHTAEGELDTGASYVSPHRALVFCQ
FT                   MKEMLDIVQNDVLKKLLPSVQYLRLDGGVEATKRQDIVNRFNTDPSYDVLLLTTSVGGL
FT                   GLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRF
FT                   KIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETADTAEKPSDTAGYEVDMVDIDGEVKE
FT                   KGKKGWLDDLGELWDDRQYQEEYNLDSFLETMKN"
FT   CDS_pept        join(complement(534984..535199),complement(534758..534900),
FT                   complement(534420..534468),complement(534213..534278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978067"
FT                   /orf_name="Pc13g02320"
FT                   /product="Pc13g02320 protein"
FT                   /protein_id="CAP91301.1"
FT                   /db_xref="UniParc:UPI0001830ACE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H4"
FT                   /transl_table=1
FT                   /translation="MASDHNLRTQFPPPRIKPANAVWLFLGPGRCYPFWQEVLGCYVVN
FT                   SGDGASGKKKCVPALDDYYECLHHRKEALRTMKMQAAYRKAEAAHPRENAPKAEQIRSL
FT                   GLLGKEEDAANVLSQREIGLLASPTRLAAYPGENNAQGKGEGNGIEDENLYTP"
FT   CDS_pept        join(535472..536999,537051..537207,537261..538362)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210383" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672166"
FT                   /orf_name="Pc13g02330"
FT                   /product="Pc13g02330 protein"
FT                   /protein_id="CAP91302.1"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniParc:UPI0001830B76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5"
FT                   /transl_table=1
FT                   /translation="MALEELSDAHAILLATHLCASGSVADLPILQARFPHCFPLERLLR
FT                   IILTFLPESTEPSQYTTVLQELANSSNLPSDRPIDTSAVQDLSESLARKRVRKIHLRPL
FT                   QRPDEEDEIASADPLTKFLIHRAHLIDSETALQPLILDLIIPFYEHSPVIRTWLISSLL
FT                   PLLRLNYEFYAHRDETISLEILESMDDQTAVNILLSLMSSEENSMDLVNNLRGLIGPWL
FT                   YGGNRSKRRRLNEAAQQSSVSFIEGSEKPQATELAGWEHVNEWLLSRSLVDRDSVVGAF
FT                   TRWDGPSDVDLGGYDNGGTQLSEEQAKDLQVRYGQSGLAVVYAHADSSMAVLEGSFQVL
FT                   TRVAKLLDLEDSSYLTPDSELPSVHYDTESMSSTSRASLLQNSLLRPTNPLTKPSPPSV
FT                   SFLSALLLSLRILTELGHLVPCRVAANMCLHSTEEMQLAELKSVVDSTVKQPNLNQDWS
FT                   MVRQRLLWLRDWQAEQFDNAWDEPSPYHGLFWRIPRDTVEIEILKALLAAKEYELAIDI
FT                   YTNSKSAPLEPAQVEAAVQEAIFTAYDNASNGNRTRGGMKRAYDILQSFTPHFPDSVVF
FT                   KQIHALIAATHALSYYSLTLQHGVPFQPVSIRVHHDPILLIEKVLEQNAKSYTKLDDLL
FT                   SIGRNLVAADVPTQAASNEAEDEPTHHKPSKEHALLTAERRITSLAIASALSSNDFGTA
FT                   YSYILTRLTPPSLLSTSSPLLNTTSVPDDITWRAVYNAGRHRATTPTHPPPTLQSQISH
FT                   LSQRMELLSLSLVLVPSPDPLPEILGAWRRCDEELTSLRAREQQEEDLWDRKGDTLSSV
FT                   PGGFGPSDSERDAFDTERQRAARRARAAMPNSHHHEAPMGLFEVARGAALALHKNAFPL
FT                   RGAADGSAPLAPRDGDRPLSPDSEGHVRKRDMVSNMMTGGLVSGIGWVLGADPVNKK"
FT   sig_peptide     535472..535546
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5 "
FT   mat_peptide     join(535547..536999,537051..537207,537261..538359)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5 "
FT   CDS_pept        join(complement(540278..>540457),
FT                   complement(539917..540208),complement(539488..539857),
FT                   complement(539305..539434))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129231"
FT                   /orf_name="Pc13g02340"
FT                   /product="Pc13g02340 protein"
FT                   /protein_id="CAP91303.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001830B77"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H6"
FT                   /transl_table=1
FT                   /translation="VFTYKFDSNGFLVKLKVRIYIYRDLXTINSEEKRIATLTIRTTYA
FT                   IFALITIFNLDTIXLNAINTFLNSDLNKVIYIXILEGFYNRGKVXKLLKALYRLRKSPR
FT                   LXXXEATRVLKKLGFEYILEDLYLFIRDRIIIFFYIDNIIIAYYRLRLXEALXLXRELA
FT                   KHXELREIGEALXFLRIRILXDIXKYKLXLYXDSYISSIATKYGLIYSRKYLTPLPANX
FT                   INKFTGIVTREXIYKYXXKLGLALYLTVITRLDTAKAANYLAKFLINLGLEHLDAINRL
FT                   IXYLYNTRYXALKFYPTYDNPTLXFSSDASFGDYINRKSSEGFLYKLFGATVNXKASKX
FT                   KIVTTSITEAELLTILEAGKIVIXXKRLFNIVRLNYKVGLTIDYDNKXTVNLLTRKXPX
FT                   IRIKLRYIDIYNHXLRXEISTSSISVRXVITTDIXVDRLTKLLLLXSYKAFITSLGLIN
FT                   IKPLVEEQIVX"
FT   gap             540460..540559
FT                   /estimated_length="unknown"
FT   CDS_pept        545228..545881
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129232"
FT                   /orf_name="Pc13g02350"
FT                   /product="Pc13g02350 protein"
FT                   /protein_id="CAP91304.1"
FT                   /db_xref="UniParc:UPI0001830B78"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H7"
FT                   /transl_table=1
FT                   /translation="MRFTTATIAFFAGLAIAAPGADQTVYETDEVTITSCAPTVTDCPG
FT                   NSGAGVEPTGSTTPSSVPAAVTSPAGEAPVSSAETPASSVETPAWSSETPAWSSVPTWA
FT                   PSVPAPSAPSSAPSAPAPPAGTPVVSNSVIAVTTCVPTVIYSTVPVTATTPAGSNVPHG
FT                   PTGGVPHVPSSSKGVATGTASVSPATSSPAFNGGATLSGSLGFAGAAAVAAFFL"
FT   sig_peptide     545228..545296
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H7 "
FT   mat_peptide     545297..545878
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H7 "
FT   CDS_pept        547999..548772
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949837"
FT                   /orf_name="Pc13g02360"
FT                   /product="Putative uncharacterized protein Pc13g02360 "
FT                   /protein_id="CAP91305.1"
FT                   /db_xref="UniParc:UPI0001830B79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H8"
FT                   /transl_table=1
FT                   /translation="MLFCLSQRRTRESLKPPPDLDYPLMDLSSLEGAPIVNPRFIVPPD
FT                   TTTPRIRTQSRASIQHLFSKPLPPRPASTDGISPTQHRNTLQDWPLDLSTIDGNIKRAS
FT                   ARRRTRPPPNEVSPDCDPRGREMRPRIQHTPRPPVRPRSCVPLTWLEDEKKWLVGEIYI
FT                   PRTPDSRPRDDIASSRSPVSPISPISPWQDMFQRLDEHLEYNNRLCRENLLRQTPSYDG
FT                   HRLSQTHDPDLGDDRVSRWVATARRMHENRRIGGD"
FT   CDS_pept        join(551074..551257,551342..552503,552556..552808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210360" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949838"
FT                   /orf_name="Pc13g02370"
FT                   /product="Pc13g02370 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91306.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI0001830B7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H9"
FT                   /transl_table=1
FT                   /translation="MDIDSQGPQNNGVNGTEERSPTPPPHQPNSASADEADSFKLAGNK
FT                   FFKDGNYRRAIEEYNKAIEINPNSSAYLSNRAAAYMSAKQFLNALEDVQRSNELDPNNP
FT                   KIMHRWAKILTSLGRPEEALEVLSRIQPPATATDRAAAEKMLRFVTQAEQTIAEDRGLS
FT                   MVIYCLDQARQGLGQGVKEPRKWTLLAAEAHLRLDNVNSLGKAQDIAISLLRENSQDPD
FT                   AMMIRARAFYALGESEQAQKLLKMCLGLDPDMKQAIKLLRIVQKLARTKEEGNNAFKAK
FT                   DYHRAIELWAQALEVDPSNKDMNAKILGNRAQAYINLKEYDSAIEDCTEALRLDSGYIK
FT                   AMKCRAKAHGKAGNWEEAVRDYKSVAENNPNEPGIAEEIHEAEFELKKSQRKDYYKILG
FT                   VGKDASDQEIKKAYRKLAILYHPDKNRDGAAGDEKFKEIGEAYETLIDSQKRAAYDNGD
FT                   ELREGMPGGMHGGMHGFGGINPDILRDMMNGGGGFGGASFGGASFGGGGFGGGGFGGHS
FT                   HGGNPFGGPGAGFSF"
FT   CDS_pept        complement(553935..556187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129233"
FT                   /orf_name="Pc13g02380"
FT                   /product="Pc13g02380 protein"
FT                   /protein_id="CAP91307.1"
FT                   /db_xref="UniParc:UPI0001830B7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G7"
FT                   /transl_table=1
FT                   /translation="MDDGPPPPPPPHGENPHTTQGEYRKSSDLPDGNYDIFIVPPHSAG
FT                   SGFLYLPSLQCNRNSFLAGVASTLVACFVWSYISPIVKAWYLATVASGSGTGMAVLAIG
FT                   VGVAGWLFGSIQSTSSGDNKGNGGARGGRFGFGGFGGGSGGPGDPGGPGGPRNAGPNTN
FT                   QYSSGANYGGNGAGQQRQQGGNFGGGQPHGNQYSGNQHGSGTPPNSDNNKREKEEAEKR
FT                   AKEERAKEERAREQRAKEERAREERAREERAREERVREERAKQERAREERAREERAREE
FT                   RIKEERAREERAKERAKEEAERERAREETRRKEELRRKMEEFKRKRDAEAKEKEKKRER
FT                   EAMEKELQERREQLEREMAAARAAAEKEARERLEREAAEARERQAKAEAEAKAKLEKLE
FT                   AEAKEKAAKEAAEKEAAAKAAAQKEAMAKFAALKEAASKKYAEKKAQDAKKEAAAKSPP
FT                   PKPASTSNVPRTPSPKKPAPYSTAKTANEDDAYSFRPYDRPRRPYAAGSVYSESSYTPS
FT                   NSTARTTPPPSHRSTYSTKDPDKIVIQGVYAFNNAFMKTPVAQLVSGQGMITDGLVLRI
FT                   TTEGLFIDDDLRGIGQREWDVKAWTLKLAEVWCPQVNAASSAKTASSNPFSFRRGNNVP
FT                   TNEESEAFLGNLLKVCKNTCRLASPSACFARSATASHDGGPVHPPQAEFRGLHILRASV
FT                   RDQEGKKYVFVLQDTEAWKVAIGLQRLRGGALVRALGVSALPVPECKTMLSALGYV"
FT   CDS_pept        join(558256..559147,559209..559306,559360..561405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210316" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949839"
FT                   /orf_name="Pc13g02390"
FT                   /product="Pc13g02390 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91308.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001830B7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G8"
FT                   /transl_table=1
FT                   /translation="MSSQSHHGHSATPRQFPVYNPVAAVAAPAGTLLPGTKIQVGSHRV
FT                   VVEKYLSEGGFAHVYVVRLPQPVNGSETAVLKRVAVPDKAALANMRTEVETMKKLKGHR
FT                   HIVKYIDSHASQLRGGGYEVFLVMEYCAGGGLIDFMNTRLQHRLTEPEIVKIFSDVAEG
FT                   VACMHYLKPPLLHRDLKVENVLISGKGSSATYKLCDFGSSAPPRPAATSAAEGRLIEDD
FT                   VQRHTTLQYRSPEMIDVYRKQPIDEKSDIWALGVFLYKLCYYTTPFEEVGQMAILNATF
FT                   KYPSYPSFSSRLKLLIGSMLKEDPRNRPNIYEVVREVCKMQGKEVPIKDIYSNRSVSEA
FT                   RKYQELPPTPTEAPAVGAVFSPPMQETEIIPEIAPMRRGRPGKSSSSQPSSERPSPSPY
FT                   RPAAEGSSSDPFAALDGSAARKKTAEEMSKRFPSLDQFDILHEKGDKFEFEPTVESKPE
FT                   DEDLSRRLTNALADDAFARRVSPERAPKPVYKRPSQNSPVRAPNLRETPAPQSVPLYQP
FT                   TPQRPTMVSTGTMTSPIQTPRLPDPKLLSRPIYRFPSSDAEHRSFSEPFTTEKEQRVTR
FT                   PHKAPSPPMSSLNVEESSRLPSDRISSQSNSARPSMETLRRPPTLEVNEPVGRSKSAIG
FT                   KARPMSVQAGVRYDPPYDSESPRSSLDMSRLQYEGGAPLRSVRTDVDRESDRTISSDVD
FT                   YLRAMEEEESNRKREKRSSGSHKHNKRGSLSTLSLSGGKNLFAGRFGDAFRRFEAGNPE
FT                   KSSSPSVEDAPRQGLIGTSDSADEGLSPNDEITLEDADRDDISPEMRRELERRRLSQEE
FT                   KRVANAAAEYRRRVAETGDGGGRTTGDGARSRTIQNKVQSLLGESEKPTVPKTATGYGR
FT                   FTETSSSLQAKQSEARPTSSSQLPASHTSGPTYAARDGSMALPDRRELPQSAAPTPYPS
FT                   TQRPAARPAAPPKPKNLRAGTATSRPGTGHDHGPSQETQTPASPGDDWEAKFSQRFPSL
FT                   SGLEMETEIKIPKISSLRTREV"
FT   CDS_pept        join(561742..561772,561826..561922,562060..562450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978068"
FT                   /orf_name="Pc13g02400"
FT                   /product="Pc13g02400 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP91309.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI0001830B7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G9"
FT                   /transl_table=1
FT                   /translation="MAPVTLKTVDDDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKN
FT                   LTLALSTLSTHTQLPPTQENQPDANTDPSNPSLASIQLPPEIIDYVDSARNPDIYTREF
FT                   VELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRGEVDRVVAATSGAVDGPDGATE
FT                   AAATSGGLN"
FT   CDS_pept        join(563010..563112,563221..563267,563326..563745,
FT                   563780..564296,564356..564743,564793..565402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949840"
FT                   /orf_name="Pc13g02410"
FT                   /product="Pc13g02410 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91310.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR012531"
FT                   /db_xref="UniParc:UPI0001830B7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H3"
FT                   /transl_table=1
FT                   /translation="MKQISEDEFPDLMKYNASSKDPIGGSVFALSPEKAKSIDCQLGVV
FT                   QSKPRPTNHRIAELEQENEILRQKCAQLRSSNTISAGRVQSEPDHSVTSESTPRTPLPF
FT                   SRVTGIGLSWNDSPSTSTRDASHPEVPENDRRNTSLYHGPTSTVYDDTSPNHDEQNRPG
FT                   QSNEEGTRHFLFSQTARQSKLDLMQYEQLEPLNLAAGKLDFDGIDPEIGMHLLSIYWSR
FT                   QLYTAQIIYRPAFMRDMACEGPYFSKLLLNAIFFVVSKHCDRPELRSDPNDITTAGWKF
FT                   RQRFTQLLRDSFDKSEMTTLQALLIMSNALFSRCDERSLSWLYAGNAFNMFIDLGLHVL
FT                   PAVDSITAEELEIRKRVLWGAYLIDKIQCLFQGRPPLLNRVNLRASLDFLDDYDELEPF
FT                   QGITYMNTKPGVIPSLNVSLLTNLCELTTIVERILREIYSESRESNLIHRDRANISEEI
FT                   KSQLRTWRQNLPLRLDYLSFPDQAVFLPQSACLLALFNVLIILVHRPLIIGHDRVINST
FT                   TAHESVNACTAAANQIVQILHDYSQHFSLSSAPYMLSYATYISATIHARIVAQKGSNSS
FT                   MFQSLVLCRNILAEHTRLYSAAEKAKENLDKLISHLGISAADDNLRTGSPGSSGSNFPN
FT                   EHMVMDESINVAREPGVADGAVEFGSSLMSLELSDLDLEAIAQGFQVDVESHSFWNSLV
FT                   "
FT   CDS_pept        join(complement(566283..566436),complement(566141..566233),
FT                   complement(565507..566072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978069"
FT                   /orf_name="Pc13g02420"
FT                   /product="Pc13g02420 protein"
FT                   /function="carbon-carbon lyase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="CAP91311.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016830"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI0001830B7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J5"
FT                   /transl_table=1
FT                   /translation="MQGLNRVKTVLDKGGLALGVWQLLPGSNMSRTLARAGYDWVLVDC
FT                   EHGNIDDAAMHEAVPAITSYGVSPIVRVPDFQSWMIKRALDAGAHGVLAPLVRTVEDTK
FT                   AFVEACRFPPQGKRGFGSPFPMDRFGRDVSATQYLTEANANLLLSVQIETKEAFDNVDS
FT                   IAAVEGLDLLFVGPFDLGNGIGHPVLGSTFAPELEQAIERILSSAHKAGKKAGIYCGNG
FT                   KQAKKYADLGYDFVNVVTDVGALTSSLASEMEIVTQKAGRTASGPYGS"
FT   CDS_pept        join(566928..567389,567437..567591,567646..568855)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129234"
FT                   /orf_name="Pc13g02430"
FT                   /product="Pc13g02430 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91312.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI0001830B80"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J6"
FT                   /transl_table=1
FT                   /translation="MGVASKADNAQVPVKQPGRTLRSSAWFDCRSNPGMTAIYMERYFN
FT                   YGITKEELMSGKPMIGIAQTGSDIAPCNRHHIELSKRVREGIRTAGGIPFEFPTHPIQE
FT                   TSRRPTATLDRNLAYLGLVEILTGYFLDGVVLLTGCDKTTPACLMAAATMNIPAICMNV
FT                   GPMLNGYSKETLTGAGTVLWHGRELYATGDIDEHEFMDYIARGTPSVGHCNTMGTASTM
FT                   NALAESLGMALPGSAAIPAAYRHRAQCAYETGKRIVEMVEADRKPCDIMTREAFENAIV
FT                   ANAAIGGSTNAPIHINAIAQHAGVEVSMDDWDTFGSTIPLLLNMQPSGEYLGEEYYRAG
FT                   GLPAIMAELLDQGKLNGDALTCNGKTLAENVRGKHTWDRRVIKPYDDPLMKDAGFAHLK
FT                   GNLFDSAIMKTCVISPAFRKRYLSNPDDPEAFEGSVVVFDGPEDYEHRLENTPHIDEKT
FT                   ILVMRGVGPIGYPGAAEVVNMHPPGRLLKEGIDGLFCIGDGRQSGTSGSPSILNASPEA
FT                   AAGGNLAILKDGDRLRIDLRKRRVDMLITDEEIEQRRKALGTEGYPILPSGTPWQEIFR
FT                   QETEQLSKGMVLRKAVKYQRLAQEGQPLRHNH"
FT   CDS_pept        complement(569181..570518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949841"
FT                   /orf_name="Pc13g02440"
FT                   /product="Pc13g02440 protein"
FT                   /biological_process="response to antibiotic"
FT                   /protein_id="CAP91313.1"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniParc:UPI0001830B81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J7"
FT                   /transl_table=1
FT                   /translation="MPQLQELFNSAVQPLPAIEDKGFASHFDTFAGSRVILLGDGSHGT
FT                   SEFYSARAEITKRLIERHGYTMVAVEADWPDAEAIDRYVRLRPGPKAQIGGKAKQYEPF
FT                   NRFPTWMWRNAEMQQLVEWMRDRNQALPPEQRAGFYGLDLYSMGASIRAVIEYLEKVDR
FT                   PTAKQARQRYGCLEPWVDEPTSYGLASLRGMEDCEAPVIKMLGELLEKRLEYASSHDGD
FT                   EYHSGEQNAHLVRDAEKYYKSMYYSSASSWNLRDTHMFDTLERLLKHNEGEKAIVWAHN
FT                   SHVGDARYTSMGYRRNEINIGQLCRERLGGDNVTILGCGTHTGTVAAAHEWDDDMEVMS
FT                   VRPSRDDSWEIVAHDTGVPSFVLELRKDRIDPALRAAMAAEQRLERFIGVIYRPDTERV
FT                   SHYSQAFLHKQLDGYIWFDRTQAVKPLEVIQPETPLGKGETYPFGL"
FT   CDS_pept        join(<570959..571793,571862..572229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129235"
FT                   /orf_name="Pc13g02450"
FT                   /product="Pc13g02450 protein"
FT                   /protein_id="CAP91314.1"
FT                   /db_xref="UniParc:UPI0001830C38"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J8"
FT                   /transl_table=1
FT                   /translation="LPVSSPSPRLDRCGQAMESLYGSFSNIEDPNTWTPPPRSGGHRGR
FT                   YLWTDAFGVVNFLTMHQEYKRTGNDTTGDDRYLVLAGRLIETVHDVLGKTRDGRSRLRG
FT                   ATDENPLSGGLRIGKTDARGPDGDGQYHHYLTVWMFALNRMAKASGDLKYNRQAIELAK
FT                   AIHPRFFVDRAAARPRMIWKMSMDLSEPLVKSEGNLDPIDGFVVFRLLQDTAMEAGDGA
FT                   FLAEEIDDYRRTMERKGEHFVSSDPLDLGMTLWTAHWFSGRERWAADLAGKCFEQIYNL
FT                   FEINQYLERNIKFRLAFREFGTCMGIQCQSEVKEKERTVDLKCYSDAIIAAWDPYMQLS
FT                   ISDDLTPADLRPITRVMYASALIPGGKLSQTILYDESGILTHFPIPAFQAGFLGPEPTP
FT                   T"
FT   CDS_pept        join(complement(572914..573801),complement(572608..572682))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672167"
FT                   /orf_name="Pc13g02460"
FT                   /product="Pc13g02460 protein"
FT                   /protein_id="CAP91315.1"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI0001830C39"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9"
FT                   /transl_table=1
FT                   /translation="MATATARPVTLLSTVLLIYPATLLLGSLFSAISPTARHSRDLSGS
FT                   SPQPASPLAPSLATDLHLSESPVNYFARKNNIFNVYFVKIGWLWTTAAFVSLLIFQPLY
FT                   SPSRRESSSQQQARFRRTLQAILRYALATTVWYLATQWFFGPAIIDRGFVATGGKCERA
FT                   LEEVEKMTAGQSSPTGLETLFTAATCKAAGGAWRGGHDISGHVLMLVLATGLLAFEAVG
FT                   ASAHAPACVSQAGPTADAGRERKASDADSTPVIDSTETGGFARTWSLRLVWGVVGLGWW
FT                   MLFMTAIWFHTWLEKIALFSGMEKPSNRLHPDVETPGYT"
FT   mat_peptide     join(complement(572914..573711),complement(572611..572682))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9 "
FT   sig_peptide     complement(573712..573801)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9 "
FT   CDS_pept        join(complement(575773..575881),complement(575626..575637),
FT                   complement(575435..575571),complement(574750..575378),
FT                   complement(574647..574677))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672168"
FT                   /orf_name="Pc13g02470"
FT                   /product="Pc13g02470 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91316.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001830C3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K0"
FT                   /transl_table=1
FT                   /translation="METEVIDSIDKGNGGALRTIKDLTAGAVGGMAQVMLGQPFDIVKV
FT                   RLQTTTQYKSALECATQIFKKEGPTAFYKGTLTPLIGIGACVSVQFGAYHEARRRLEEL
FT                   NKKKYANSALSYTQYYMAGSFAGLTNSVLSGPIEHVRIRLQAQPHGAGRLYSGPIDCVS
FT                   KLAAQGGALRGIYRGQAVTLLREAQAYGAWFMAFEFMMNGDAKRNNIKREDMSKAKIAI
FT                   YGGLAGEVLWLSSYPFDVIKSKMQTDGFGAEQKFSTMRDCFKKTYAIEGLGGFWKGIGP
FT                   TLLRAMPVSAGTFLTVELAMQALG"
FT   CDS_pept        join(576150..576173,576224..579095,579157..579308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949842"
FT                   /orf_name="Pc13g02480"
FT                   /product="Pc13g02480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91317.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI0001830C3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K1"
FT                   /transl_table=1
FT                   /translation="MHRRPICRLSRRAEWSNSAYRTPTLTALTARRTIRLSATRWNSLG
FT                   PSNENDDGTASNPAPTKPKFGSRWGSKQATPSAGLSFAEQAMRQTLVANNQPPPPVPAP
FT                   TQRRQERSNQQLNSGQSNQQRKPYVRRVSPRDNQDAHMMGSRETPRHQRRSPFGQEKNP
FT                   FKEENTGSYTRWPKGSSRNQERNPFSRGTKPAFEEENPFAPEKTQNRFQGQFQNRATRD
FT                   HPMAHNDWKCPECMKHVFASKQVCPFCKASRPSDAQPKFRITREYSDSPGPSQFKQSRS
FT                   PSEYTSKFQQLGESVLTELEQDVQPNTTETTKRHSEKSDRPRTKEEAEDFKKNQWSWDM
FT                   SALEQLENLEEQEQPPPSKPMKRREGRKGRENESDGADFDSEDRERLRAERRRQQKEKN
FT                   AQRAAKKAAAQAAPAPLYLPEFISVSNLADVIGVRPAQFVQRMEDMGFEEITYRDILDA
FT                   ETAGLVAAEFNYEAIFDSGKADLHAAPELEDTSGLPPRPPVVTIMGHVDHGKTTILDWL
FT                   RKSSVAASEHGGITQHIGAFSVMMPSGKAITFLDTPGHSAFLEMRRRGADVTDIVVLVV
FT                   AADDSVKPQTIEAIKHATQAKVPVIVAISKIDKEGNNPDRVKGDLSVHGIHVEDYGGDV
FT                   QAIGVSGKTGQGMVELEEAIVALSEMLDHRASTTCNVEGWVIEASTKSYGRVASALIRR
FT                   GTLRPGDIIVAGTAWARVRTLRNEAGVAISEATPGMPVEIDGWREQPGAGTELLQAPTE
FT                   QKAKDVVDYRLEKSDTQKMGIDMVAINEARRELLEKRRRENEDEETAKEVEPTGPKSVN
FT                   FVLKGDVDGSVEAVLNSVAAVGNNEVFANIIRSGVGPVSEFDIEHAGSANGKIVSFNQA
FT                   IDPNIMRIAEAEGVDILDHNIIYKLIDDIKAILSEKLPPTITTRVTGEAEVQQVFEITV
FT                   KGREKTAIAGSRVRNGLINKTRKVRVLRGEEIVYDGAMVSLKNVKKDVTEMRKDTECGI
FT                   AFENWTGFAPGDHVQCYEEISEKRYL"
FT   CDS_pept        join(complement(582038..582097),complement(580332..581987),
FT                   complement(579876..580262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824874"
FT                   /orf_name="Pc13g02490"
FT                   /product="Pc13g02490 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91318.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830C3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K6"
FT                   /transl_table=1
FT                   /translation="MDLKTRLRKACDACSIRKVKCDTGGPPCRSCASLDIPCTYERPSR
FT                   RRGPPNRHAEAFKKQKREPEDTASLSPADYPSAATPLATPLTNPQCASVSLSVESICSL
FT                   HTMQMLLDDFFTYIHPLVPIPHEPSFRAAFERREDVTNHTFLALLASMIGLLVASFPRR
FT                   PKLRLNTEAERTAFPNSIALVKRCLDVAIQARGTGYLDRDATVYDAAISYFLAICAGYI
FT                   YNMRRCRVYLSECRAMLQVYDLCRSPTTTNRPSSTLGPLSPLSPASVTVLDSPAHNFTE
FT                   SRGVDLITQELGRRLFYVTFVGYQTLHQMGSSDIKVHVPPETPTDRYPPLPLEIDDEFL
FT                   FSTHVEPQPSDRVSRLVGFNANVRVYSSYTALLAWEIAFGSGQIFDWEHQRNCIWDCLK
FT                   RAKSALIDVPAELSLHHPKHVSPAGLSGLGEDDTIFSYSNDHIHQERRAIQYEIQKANI
FT                   YASQLCNRSFLVEKYWSLFETFSKYGKSPKFTAPGSTTPHIKMEGRPDSVPSASASATP
FT                   TGTASSETSTQAQPHAETDYIGRMMAEERKLVIKDLFVLLRTVNEVNMEPNGASITNKI
FT                   RQVASTLLSLSHKPNQSNTEIPNLTTAAAPSPSPTTAPPGLHILTAAEAESYLHAFIET
FT                   LVRLECHSAMGDAANSADGVSPQMNGRAMSYLSDYERDQEELSQWASLKEYQQKFAEAG
FT                   GVLHQL"
FT   CDS_pept        join(complement(583568..583618),complement(582944..583521),
FT                   complement(582718..582892))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672169"
FT                   /orf_name="Pc13g02500"
FT                   /product="Pc13g02500 protein"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91319.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI0001830C3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K2"
FT                   /transl_table=1
FT                   /translation="MSRLLDPSRAAWLYPFWGIYYFASNRFLWPLFKARLVPIVLLSSF
FT                   IYFILFFFTYLPQVAFLAIFQGSSAWVSGAFLVLGEGAAIVAALFEAFFVDETLVDIFD
FT                   AVLVNEGQEELVTTSRVIYPEPGNPAKRLGTPTTSAVYSPFSLRQIVEFIILLPLIFIP
FT                   VAGTPMFLLLTGYRAGPFHHWRYFHLLDMTKQQRKESISRRQLQYTTFGTVALILQLIP
FT                   PFSMLFLMTTAAGSALWVTDIERKRRAINQQSSRLGEQYRDDIMP"
FT   CDS_pept        join(complement(584603..584791),complement(584024..584551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949843"
FT                   /orf_name="Pc13g02510"
FT                   /product="Pc13g02510 protein"
FT                   /function="hydrolase activity, acting on acid halide bonds,
FT                   in C-halide compounds"
FT                   /protein_id="CAP91320.1"
FT                   /db_xref="GO:0019120"
FT                   /db_xref="InterPro:IPR005833"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006388"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001830C3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K3"
FT                   /transl_table=1
FT                   /translation="MTAKTVVAFDLYGTLLSTESIAKQLEKRCDNAKAQSISALWRRYQ
FT                   LEYTWRLNSMGKPHFQSSTRNSLLHALADNNEQLSDDHIEHLMQAYNDLSTFSDVNPAL
FT                   AQIAADPSIQAVIFSNGTKTMLSNSVLRSKDLSPHASVFQDIVTVDEVQQYKPSKASYE
FT                   HLAKQTGQDPLQMSKLWLISGNPFDIVGARATGMQAIWVDRVGAGWKDAVAPDLQPTAI
FT                   VHDLKHIVKEINRHQI"
FT   CDS_pept        join(584952..585137,585248..585826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949844"
FT                   /orf_name="Pc13g02520"
FT                   /product="Pc13g02520 protein"
FT                   /protein_id="CAP91321.1"
FT                   /db_xref="UniParc:UPI0001830C3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K4"
FT                   /transl_table=1
FT                   /translation="MTSGENYAVFRECLSNAIVARSEEKPTRRKPKVKRAERKDVKTAT
FT                   TFSTRRADPEELAEFVDFLASETFAIFPTPLQTLSYAAIQHDPSLSALYIPPDTDTPLP
FT                   RATLETIFSPIPVSVTDSLLVYGIIPDRADLVDFLAPVLTEYISSVTTGPPAWASTRAD
FT                   ACEICERDWIPLSYHHLIPRGVHAKVIKKGWHDEWMLNSVAWLCRACHSFVHRMASNEE
FT                   LAREWFTVERICEREDVQDWAKWVGRVRWKAR"
FT   CDS_pept        join(complement(587890..588090),complement(586128..587858))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129236"
FT                   /orf_name="Pc13g02530"
FT                   /product="Pc13g02530 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91322.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003566"
FT                   /db_xref="UniParc:UPI0001830C40"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5"
FT                   /transl_table=1
FT                   /translation="MLRFQFFLFLLLPWMASAGPIFRWLSPSLESPEPTSLPLLPDIER
FT                   REPGGITAITPVAAPTQLPFTPTIKPTKLTIFPKPTTTPEPTATPEPTTTPEPTATPEP
FT                   TTTPEPTTTPEPTATPEPTATPEPTTTPEPTTTPEPTTTPEPTATPEPTTTPEPTTTPE
FT                   PTATPEPTTTPEPTATPEPTTTQEQATTKKSTTISHASTTTRLSISSSTTPGVLHSSPI
FT                   TSSLPVHVPGSTSSLGSLVIPSSAQSPSDSLPGGATSIKATTATPSVSTSTSTQPTTTP
FT                   VPTVPTSSSIAVGAIAPLGGASSSSSSTSTPVIPTSNPIQPAKATQAQSTSLQQISTSS
FT                   SKPVVTVTEPVIVYVTKGAPKPFSTSVIHHTPSVNNSPVSSAKPTVKPSVEPTTTSLMF
FT                   VTIHSTATSVVRVTVYPSSSSSSSSSSSSSSSSSASSYSALSSSTGSAPSVNAAPIVLT
FT                   TINSATQSLSSSSLLLSSSSEIAPVVTAHVTSTSVVPLTVYPATSPPASSLLPPSSEAA
FT                   SIVTVRVTSTSVVPVTVYSTTSPSAPLLPSLSETAPVVTVHVTSTKTLLVTSYGSTATA
FT                   AETTHPADPTSAVDANIATPTSKQGQGILTVIPVTPPGFVTITETETETKTVTDRITET
FT                   VTATVTRG"
FT   mat_peptide     join(complement(587890..588036),complement(586131..587858))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5 "
FT   sig_peptide     complement(588037..588090)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5 "
FT   CDS_pept        join(complement(591057..591268),complement(588913..590995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949845"
FT                   /orf_name="Pc13g02540"
FT                   /product="Pc13g02540 protein"
FT                   /protein_id="CAP91323.1"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="UniParc:UPI0001830C41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K7"
FT                   /transl_table=1
FT                   /translation="MTNFRMGVTFAGVTLSVLVFLQLIAVFKLDSQPQSPLPGLSSNFN
FT                   QWKSRANAAAADDIFLVGAGKADVTGPVVEIAFAGYASLDQLGGGLKQRLYSRAFIFAD
FT                   PNKPDETFVYLVLDTLTGDTAVRHGVLEGLTALGGKYARYGEHNVAMTGTHSHSGPGAW
FT                   MNYLLPQIPALGFDKQSYQAIVDGAILSIIRAHENLVPGRLSFGSIDLEDTNINRSPFS
FT                   YEHNPDEERARYSANVEKSLSLIRFDRESDNKTAAILTWFPVHGTSMYNNNTLVSGDNK
FT                   GVAAYLFERSVDGDARFTDDAVIGFSQANVGDTSPNILGAWCEDGSEEMCRYEDSTCGG
FT                   RNEDCHGRGPFFREKDNGAKSCFEIGRRQYSAAKKLYEEMDTTPIKITGGSAVKSFHVY
FT                   QDMNGYTFPSPFNSSTLTTCPAALGYSFAAGTTDGPGAFDFTQNVTGPAGRNPLWKIAR
FT                   AVIHQPSKEQQQCQSPKNVLLDIGTLTEPYAWAADIIDIQVLRVGQLFLIISTSEATTM
FT                   SGRRWKEAIAKGAKDYLSVSDPLVVLGAPSNSYAHYVTTEEEYGAQRYEGGSTLYGPNT
FT                   LAAYVNLTLTYLPYLGSSLEVAKLPAIQPGPSPPINTNRSLSFIAGVVYDGAPIGKHFG
FT                   NVTSNPGSGPYGPGDIVKTTFVGANPRNNLHLESTYAAVERKNDYGTWEVVRNDRDWNL
FT                   VFTWKRTNEILGHSEVTIEWEIEDEYYSIDTTSPPQAGTYRMHYYGDSKNPLGQISPFE
FT                   GISGTFTVKTS"
FT   CDS_pept        join(592100..592136,592194..592807)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129237"
FT                   /orf_name="Pc13g02550"
FT                   /product="Pc13g02550 protein"
FT                   /protein_id="CAP91324.1"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniParc:UPI0001830C42"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K8"
FT                   /transl_table=1
FT                   /translation="MPLINESHDSLPYIDAAPTASAQARAQQLINAELSPEHASAMHPW
FT                   IPEAPEPKFSQFMQQELARKAQGAPLTGGIDLSRYEAPEAPTRTSDTDSPDLDTWRQTL
FT                   QKAYASSSHLSKRHENLALLEEHGKNAWLIGNSQLEEILGSLEKELAETKEASEEVNKQ
FT                   RKIAQEASQGELVSLEETWKQRLGAILDVEVASEQLRMQRLDYMRQVAQQQAR"
FT   CDS_pept        join(complement(594779..595007),complement(593551..594722))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949846"
FT                   /orf_name="Pc13g02560"
FT                   /product="Pc13g02560 protein"
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="CAP91325.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830C43"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K9"
FT                   /transl_table=1
FT                   /translation="MTWLIAAGLVGLGALYMWHVNSAMKIVPEEARKLSPHRWTVEEIE
FT                   AAYKKSMKAPIDVTKSLPPKQSRRYVIVGGNGLVGAWIVSHLLARGEDPKAIRILDIVS
FT                   PEQDVINKGVGWIKTNITDELAVTTAFEEPWVANVTNLPLTVYHTAAIIRPQDRLKSFL
FT                   PLSSKVNIDGTRNVLNAARAAGATAFIWTSSGSIALHQPTFWIAPWATQPKRVVQVVSD
FT                   STKLPESHDQFFGNYAVTKTEAERLVREADDPAINFRTGCIRPTNGVYGTGGQANNIIT
FT                   GVYLQNGGSPTWARPILQSFVHAENVSIAHLLYEQRLIQQSEPGSKLPNTGGQAFTVTD
FT                   PNPAIAFEDLYTLLTTLSRTPLAFPEVQPLPLLVMAYFIELYTFLQYKYLSWFLPRLSG
FT                   DIAQLQPSIFSIINVHVFADDSRARLAPEMGGLGYNPPLSTLEGLCRRLVDWNTKAERE
FT                   GVEAGTNM"
FT   mat_peptide     join(complement(594779..594938),complement(593554..594722))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K9 "
FT   sig_peptide     complement(594939..595007)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K9 "
FT   CDS_pept        join(596531..596862,596921..597297,597359..597635,
FT                   597699..598428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129238"
FT                   /orf_name="Pc13g02570"
FT                   /product="Pc13g02570 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91326.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L0"
FT                   /transl_table=1
FT                   /translation="MAAQHSNSESQEKWPQNTETVSQDTDSIESVSTVETQTDRDALGK
FT                   TLTARASRTSHMSLSERVTTIATNATADPDYEVDWDGDDDPENPKNWNLKYKSMGIVFL
FT                   SWNTLIVVLYSTSYTSGITLMAEEFAQSGTIVTLGLTFYLFGLAIGSMFMAPLSEVYGR
FT                   KPVCVICLAVFTVLIIPCALAKSVTALIVVRFIAAFFGSVMISTAPGMVADLVDDEHRA
FT                   LAISVWSIGPLNGPVIGPVIGGFVTQYLGWRWMCWIALILSAIALVFAILLKETYAPTI
FT                   LQKKAARLRKETGESRWWSRYDQKASLPEILKLNLSRPFVMAVTEPICIFWNIYIAIIY
FT                   GILYLCFVAYPIVFRDIRGWQLGVSGLAFLGIGIGVLLTIACEPLIRRLVNSHPKDPET
FT                   GKPHPEAMVAFVCICATIIPVGELWFAWTCSPASIHWIVPILAGIPFGAGNTGVFIYAS
FT                   NYLTHSYGMYAASALAGNSVIRSILGGVLPLAGSSMYASLGPNWAGTLLGLLEVVIVPI
FT                   PFVFYKYGHKIRMKSPLIVRMQEEKTKLEGKRAKRQLRLQQVNQADEKKVEEAV"
FT   CDS_pept        complement(598607..599017)
FT                   /pseudo
FT                   /gene_family="HOG000200297" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(599628..599802,599899..600103,600186..600394,
FT                   600452..600531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949847"
FT                   /orf_name="Pc13g02590"
FT                   /product="Pc13g02590 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP91328.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001830C45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L1"
FT                   /transl_table=1
FT                   /translation="MWSWFGGAAAQKRKDAPKNAILQLREQLDMLQKRERHLETQISEQ
FT                   EAMARKNVNSDKNAAKNALRRKKVHEKNLEQTTAQIMQLEQQIYSIEAANINHETLAAM
FT                   KQAGAAMKQIHGGMKLEDVDKTMEELQDQHALSAEIGSVITSFPIGEQPDEDELDAELG
FT                   NLEQEALDAKMLHTGPVPVGSQLDRLPAAGNTDLKQPAKAQEEDDEEAELAKLRAEMAM
FT                   "
FT   CDS_pept        join(complement(605096..605144),complement(604844..604987),
FT                   complement(603847..604768),complement(603174..603786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129239"
FT                   /orf_name="Pc13g02600"
FT                   /product="Pc13g02600 protein"
FT                   /protein_id="CAP91329.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI0001830D07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E6"
FT                   /transl_table=1
FT                   /translation="MPRKLRAAAQAAAKSIKNVPSIPDGSDEEMVDVPSSHSSSPIAEQ
FT                   EDSPEKDPDVELEAEPESKQEELAAATPAGDSILADTDNTPSYGPGRPSLPPRGKRRIG
FT                   RPPKYPRPEWNPADGEQPLRVTTPVKRRRGRPAASGGRWARNRGPSHLTQVPVDKEGNM
FT                   MDVINDEVSIPPDPIGATKVDENGHLQGGREYRVRTFKILGRGDRLYMLSTEPARCIGF
FT                   RDSYLFFQKHKMLYKIIIDDDAKRDLIERDLIPHSYKGRAIGVVTARSVFREFGAKIIV
FT                   GGKKITDDYDEAAARERGDVEGELAVPEDRLPGPGETYNRNQYVAWHGASSVYHTNAPA
FT                   VPLVGGKPVDTKKRRVPVTDDNWMLEHARAASNFNSKLAEMRRKNLGGVYDVHTNIMQH
FT                   PKIMQPTHARWERVSPAPASVPTELTANMNLLNLSNGGSPSAHENQTSHETQESHEATT
FT                   GETATERLATTFSPVPAHLHDRCVIQDIVYESPPYSNMGIPGPDGDVHDIGPNGLVSVA
FT                   NPEHPEFMTPEILELLPPGCKEALVDAAAQEVEWKSKWTSETKDGERTQPTKSYAWYP"
FT   CDS_pept        join(complement(607012..607260),complement(606585..606821),
FT                   complement(606459..606536))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824875"
FT                   /orf_name="Pc13g02610"
FT                   /product="Putative uncharacterized protein Pc13g02610 "
FT                   /protein_id="CAP91330.1"
FT                   /db_xref="UniParc:UPI0001830D08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E7"
FT                   /transl_table=1
FT                   /translation="MIAFFRSRSIVRMTVRPRTCGYTRVPYQKRLRGITNSPLSMRPFP
FT                   FDFDTCTYLSFPSLIALRISISTLTAGYLILASDDNIGIKSSFTHREIVTTFSFQYGPG
FT                   RALSSPCICIPGEIVRYAVVAVGRSQASTCVIGARREVPASALTCGSADLRPGSCMNDK
FT                   EKETLESFADLRFGPSDYSIHGLE"
FT   CDS_pept        join(608075..608127,608418..609649,609714..611113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949848"
FT                   /orf_name="Pc13g02620"
FT                   /product="Pc13g02620 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91331.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0001830D09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E8"
FT                   /transl_table=1
FT                   /translation="MAAQSGPVLHGDDMKTMNSGLEDDSQDQIRSNDSTPTPTGIATPE
FT                   PDPVDKRLPSIMHNYFQVGSFSGDKASLPRLWSCLSKPSEDSQSNAHTQHSSDSSESFV
FT                   MMEQEDGPDKMEEHPSLHTPPHSLLQHESDEMELGTSPGVSSIFTTLKSYLISPTQTPP
FT                   EDHPSRRQTSLPVSSISDDPVLATHFSNPSLPPTSDAFSLIEAPLLDHEKPHVPISSEN
FT                   LAKLTESVPDGLRLKNTPPLTPRAMSNEVPAAQEKNATSAPQESAQETPPSESKPEDME
FT                   SSTDEITMKLDEAFPSQSQSEDAPASPTSTSPANGAPTGPINGKLFVKITDGRGLRPSF
FT                   DPYVVCVFEWNEYISKGARDGEEEKKRRQQESDAEEAAGRPMAIPLKTRSSSHNSAVEG
FT                   DHKGRTPVTDPHWDHEATLYVTPTQLFTWVYDRNNQEAFLGHVRLRVNLKEDHSRLEGW
FT                   FPLVARGAGDNQVSGEIHLDMKFEKTDRKQVGPNDFLVLKLIGKGTFGQVYQVKKKDTQ
FT                   RIYAMKVLSKKVIIQKKEVVHTLGERNILVRTAMTASPFIVGLKFSFQTPTDLYLVTDY
FT                   MSGGELFWHLQREGRFQEARAKFYIAELILALQHLHEHDIVYRDLKPENILLDANGHIA
FT                   LCDFGLSKANLSQNDTTNTFCGTTEYLAPEVLLDEQGYTKMVDFWSLGVLVFEMCCGWS
FT                   PFYAEDTQQMYKNIAFGKVRFPRDALSTEGRNFVKGLLNRNPKHRLGANGDAKELMAHP
FT                   FFHDINWDTLCRKEVIPPFKPQLQSETDTSNFDPEFTNAMELNNSLNLRAANVANGLMP
FT                   ASTPLSPGMQANFKGFTFVNESSIDHHLMDDSDHMEDDAMHDDHWQRGHRSGNSVDQRM
FT                   TGVQKTHDGTEPGIFNVDDTFDM"
FT   CDS_pept        join(complement(613111..613475),complement(612555..613047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672170"
FT                   /orf_name="Pc13g02630"
FT                   /product="Pc13g02630 protein"
FT                   /protein_id="CAP91332.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001830D0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D1"
FT                   /transl_table=1
FT                   /translation="MSVHKTTEYPISRVGTPPSIPAKTLLLVHQIPELGEQQLREFLDR
FT                   TVRDGHDIRHLYQVMIDAIRSNKVYLVKELLRCKMPISPIYVREAVKGKAKDILTVFFD
FT                   NGWDINAPMSGMNPPILTNALKDLDMTIWLLDHAADPNTRCDIDTTPLSYAVRHTDLPT
FT                   IDLLLRRGGDVRIGQLVHNAIYRESDTLKVVETLVDRGASLDSLMYQDHQYSWNMFPFM
FT                   RETPLHTAVALRRHDVIRYLIHKGANVKIENYRGQTVMQSADEDTKRVIMQEIQESSTF
FT                   HASL"
FT   CDS_pept        complement(613712..614394)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(614937..615027,615180..615410,615515..615555,
FT                   615838..615948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949849"
FT                   /orf_name="Pc13g02650"
FT                   /product="Putative uncharacterized protein Pc13g02650 "
FT                   /protein_id="CAP91334.1"
FT                   /db_xref="UniParc:UPI0001830D0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D2"
FT                   /transl_table=1
FT                   /translation="MFQRGYRKTSSQRKTAQSVACSRQSYGSGPVDAQRDQDVIEGVAT
FT                   GRPGSVPGYLLAALMHCPKLLEGISDGDWRHFEGEERAEELAESDRTQKALVLVADRKA
FT                   CEEGEPLSEIVDNEDEDGRLTLVCGAPQAQDAAQDAARGPVGRSGLAVRGGPG"
FT   CDS_pept        616696..617133
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949850"
FT                   /orf_name="Pc13g02660"
FT                   /product="Pc13g02660 protein"
FT                   /protein_id="CAP91335.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001830D0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D3"
FT                   /transl_table=1
FT                   /translation="MTSKPKPAILPSTYTRTTPPETFPTPGHGDISWHTLISSPQTEST
FT                   DLCAGIATCPPATGHLCAHRHTQSEIYHILEGEGNVTIDGVVSRVQAGSTVFIPSDAEH
FT                   GIVNTGPADLRWFYVFPTGSFGDVVYRFTEDEGEAKGKAKL"
FT   CDS_pept        join(618980..619365,619447..621352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949851"
FT                   /orf_name="Pc13g02670"
FT                   /product="Pc13g02670 protein"
FT                   /protein_id="CAP91336.1"
FT                   /db_xref="UniParc:UPI0001830D0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D4"
FT                   /transl_table=1
FT                   /translation="MSVVATRTETPVVSYNSIPENHVDYTVHSRTSSISSYRTNYTTST
FT                   APTTYSPSSPSSSYRQCDSVNSLPKLTEPIQRRVPHEVYEVIINHLEELHKGQHQTGCT
FT                   TCFQRDLHALSLTCRSWEKAVRGPLYHSIHIVGNDSPAQLKKYRLKRGSRLKLLRRTLR
FT                   ERKLLANLVYELRVPQLDLLFTTTKQGPQWQEYRDLVASVVMVCPNLERLLGLSIPYHH
FT                   EFDRLTHALSTRKKLKEHTWVLGEPAEVSELSPRDDSCPGSLGPSQMFEFLNYHTSWTS
FT                   LETMMLYGLNGNGALEPSISLRMFNLLPSLRNLCITSFNKDSFDDNTLMCLPPLESLRL
FT                   ENLPGITDAGLSQYTSRPESLSLRTLVLIEQNVESLLVISKILASLRGLERFKIVQTGK
FT                   CPTLPGDHMIFQPILASSTLKYLHWDVACPDPGTALTQLDTLPFQKPTKPSNTPNYHLA
FT                   QSIISAGFPQLEALRAPSDVEPPGALQAVCRPILKGQALLRPDRYSLPRSSHGSVNTRP
FT                   LALPAGNNLTSARIRAQTFIDMAAKDTEAGMPVLIQDYSDSYVPDNAQNSQFEDDPDQE
FT                   MDDYGIWAACERFKHKDNDHNGPKTVYEFRMPTLMGRSGFRDPATGASIPHFILRPDIP
FT                   GQELDGGLIGWKQLLASNQSLSYAAGVGVNCFNSGNPSIPPPEEPMSPSSSISRFGWGS
FT                   LSGRSMTGTSPTTPTTPLMPTSSASGSALPWEKDTCTGTWNHKAGRDWWFHMERDRPGN
FT                   SELVDIKQLF"
FT   CDS_pept        622004..623950
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000259232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949852"
FT                   /orf_name="Pc13g02680"
FT                   /product="Pc13g02680 protein"
FT                   /function="ATP binding"
FT                   /function="glutamine-tRNA ligase activity"
FT                   /biological_process="glutaminyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91337.1"
FT                   /db_xref="GO:0004819"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006425"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniParc:UPI0001830D0E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D5"
FT                   /transl_table=1
FT                   /translation="MDPAKPVDLPERPKEATEPTVPPKKSKSQEKKEAAAAKKAAAKLA
FT                   AKQDQPKSKGEPKAPKAKEAPAPRDPQAMFKVGFLHDVYQEKPLSETVPKIRTRFPPEP
FT                   NGYLHIGHSKAIAINFGFAKYHGGECILRFDDTNPEGEEERYYNAIREIVTWLGFTPVR
FT                   ETNASDNFDRLYELAEDLIQRDGAYVCHCTKAEIKAQRGEVEGGQRGGERFACSHRTRP
FT                   IEESMAEFRAMRDGKYKAGEAALRMKQDITDPNPQMWDLFAWRIMGSEDKQHHLTGGKW
FT                   KIYPTYDFAHCLCDSIEEISHSLCTTEFELSRVSYEWLCDKLEVYRPNQREYGRLNITG
FT                   TVLSKRKIIQLVKEGHVRDWDDPRLYTLIALRRRGVPPGAILSFVNDLGVTKNTTNVQV
FT                   TKFEQIVRQYLETTVPRLMVVLEPLKVIIDDLPEDHLELIDCPFSKDPAFGTHDIPFTK
FT                   TVYIERSDFRAVDSPDYFRLAPGKTVGLLKVPYPITATSFETDPATGEVTCVHAKYEKP
FT                   AEGEAPVKPKSFIHWIGESPAHNSPIRAEVRAFNSLFKSEDPSAHPAGFLADINPDSEE
FT                   IFKDAMVETGFRDISRSAPWPKEEGAGEPGENKHSIRFQGMRVAYFAVDRESTDEKLVL
FT                   NRIVTLKDTQGKN"
FT   CDS_pept        join(complement(625794..626107),complement(625250..625665),
FT                   complement(624530..625188))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672171"
FT                   /orf_name="Pc13g02690"
FT                   /product="Pc13g02690 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91338.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0001830D0F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D6"
FT                   /transl_table=1
FT                   /translation="MSTLEDLDDLEQEQRDKKQDQNDGDGKKPEGDGDADMKDADKNDE
FT                   EEEMLDEDILNSSTADIVTRRRMLENEMRIMKSEFQRLTHEQSTMREKVKDNQEKIENN
FT                   RQLPYLVGNVVELLDLDVEAEAAEEGANIDLDATRVGKSAVIKTSTRQTIFLPLIGLVD
FT                   HETLKPGDLIGVNKDSYLILDTLPAEYDNRVKAMEVDEKPTEKYTDIGGLDKQIEEIVE
FT                   AIVWPMKEAERFKKIGIKAPKGALMYGPPGTGKTLLARACAAETNATFLKLAGPQLVQM
FT                   FIGDGAKLVRDCFALAKEKAPSIIFIDELDAVGTKRFDSEKSGDREVQRTMLELLNQLD
FT                   GFASDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPNEEARANILQIHSRKMSVED
FT                   SVNWAELARSTDEFGGAQLKAVCVEAGMIALRKGQSKIGHENYVDAIAEVQAKKKDTNM
FT                   GIYV"
FT   CDS_pept        join(complement(628026..628120),complement(627949..627966),
FT                   complement(627818..627884),complement(627702..627762),
FT                   complement(627538..627646),complement(627381..627480),
FT                   complement(627229..627328),complement(626690..627172),
FT                   complement(626394..626509))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949853"
FT                   /orf_name="Pc13g02700"
FT                   /product="Pc13g02700 protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="trimethyllysine dioxygenase activity "
FT                   /biological_process="carnitine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91339.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0045329"
FT                   /db_xref="GO:0050353"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR012776"
FT                   /db_xref="UniParc:UPI0001830D10"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D7"
FT                   /transl_table=1
FT                   /translation="MAWNGRQSGRTMPDIVTFPGKAKDGREVVLNFGRFFLRENCQCPK
FT                   CIHPDTMQRISDTFSIPQNVKIESIEHNDNMVEIKWSDNHLGLYSYDWLYAHAQSDVYI
FT                   SKTNPVSYPTRIRRFSPVMDPDQSPRVKYDDVMSDDESLHIWLSHIWDQGFCFVDDVPI
FT                   NPEATQYLIERIAFIRNTHYGGFWDFTADLTFKDTAYTNEFLGAHTDNTYFTDPARLQL
FT                   FHLLSHTEGSGGENLLIDGFAAAQQLRDESHKDYVQLVKHRQPWHASGNEDICIQPSAM
FT                   APVFSIHPDMDKLYQIRWNNYDRAPKTDWSASEQTSWYRAARHYNEILQTREMWTKLKP
FT                   GSALINNDDYISRLRLLKFGRKEMLDNLGNVKLNSRNPYYFI"
FT   CDS_pept        join(complement(629709..629828),complement(629228..629654),
FT                   complement(629079..629172),complement(628667..629009))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949854"
FT                   /orf_name="Pc13g02710"
FT                   /product="Pc13g02710 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91340.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniParc:UPI0001830D11"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D8"
FT                   /transl_table=1
FT                   /translation="MSAPGAGHEFPAQEVSWQKRDVLLFANSIGVKADELHFLYELHPN
FT                   FAVFPTYSLILRMSKNTSDFRTIALTPKPLAFKLTDQEVTDFYARQKAVHIPGVPDLDH
FT                   RHGVDGQRKITILKPLPTTSAGRKFELRNKVIGVYDKGKPGTVIETEQSIVDKESGEVY
FT                   SKVVSSGFLVGQGGWGGPKGPSTVNYAPPEGRAPDATHVVQSNSETAHLYRLNGDYNPL
FT                   HATPEPGQKMGFGGIIIHGLFSWNSAAHGILREFGGSNPANMKEFQARFASPVRPGDKL
FT                   TTEIWRMGNIQDGYEEIRFVTKNDKGRVVLSNGRCLLKVTGVKSKL"
FT   CDS_pept        join(complement(631740..631831),complement(631670..631683),
FT                   complement(631573..631592),complement(631398..631507),
FT                   complement(631007..631338),complement(630476..630951))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672172"
FT                   /orf_name="Pc13g02720"
FT                   /product="Pc13g02720 protein"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91341.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI0001830D12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D9"
FT                   /transl_table=1
FT                   /translation="MDTESDSPQGITSSADRMVGMEHSEVRYFTSYDHHGIHEEMLKDD
FT                   VRTRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAARAGAKHVIGVDMSSIIEKARQI
FT                   VEVNGLSDKITLLQGKMEEVNLPFPKVDIIISEWMGYFLLYESMLDTVLYARDTYLNPG
FT                   GLIFPDKATMYVAGIEDGDYKDDKIGFWDNVYGFDYSPMKEIALNEPLVDTVEMKALVT
FT                   DPCAIITFDLNTVTTADLAFKVPYALTAKRPDFIHALIAWFDIEFSACHKPIHFSTGPH
FT                   AKYTHWKQTVFYLRDVLTVEEDERVTGWVENRPNDKNKRDLDISISYKFETPDATRAAE
FT                   GGCFYRM"
FT   CDS_pept        join(632518..632643,632693..633567,633629..633683)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129240"
FT                   /orf_name="Pc13g02730"
FT                   /product="Pc13g02730 protein"
FT                   /protein_id="CAP91342.1"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI0001830D13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0"
FT                   /transl_table=1
FT                   /translation="MNLGVGRANLYTLFAFVFLASLIGKSNASLGDHLPDFKECVQVCK
FT                   TENCQNGNSVLRMSNHHPNSSPRLALLTSLALHHRLLLWTCPAECDYTCQHVITDRRVS
FT                   RDPPMISPIVQFHGKWPFRRLLGMQEPFSVLFSFFNFAAHWHGMSRIQESIPAWHSLRP
FT                   YYMMFGYIGLASWSFSMIFHMRDFPLTEKLDYWAAGANVLYGLYLAVVRIFRLDLENTP
FT                   YRPTLRRFWTAICILLYTLHVGYLTFWSWDYTYNMIANVVVGIIQNLMWTGFSIFRYRR
FT                   LEKSWAAWPGMIVAWIIMAMSLELLDFPPWNGLIDAHSLWHLGTVVPAVWWYSFLIKDA
FT                   QDDIAAHRLKA"
FT   sig_peptide     632518..632601
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0 "
FT   mat_peptide     join(632602..632643,632693..633567,633629..633680)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0 "
FT   CDS_pept        join(634098..634190,634259..634272,634379..634523,
FT                   634597..634611,634672..635163,635219..636079)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129241"
FT                   /orf_name="Pc13g02740"
FT                   /product="Pc13g02740 protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphoacetylglucosamine mutase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91343.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004610"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="UniParc:UPI0001830D14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E1"
FT                   /transl_table=1
FT                   /translation="MASPAVKKAITEAALQYAKPEGKVFEYGTAGFRMKADLLNTVVFA
FT                   VGLLASLRSKKLSGQWIGVMVTASHNPAEDNGVKLVDPMGEMLEAEWEAYATRLANAPL
FT                   DKIADVYDELIKEIDVKMTNPARVVFARDTRASGSRLVGVLNAALTATEVEFVDLKYMT
FT                   TPQLHYVVRCKNTLGTQYEYGEPTEQGYYEKLANSFKKVMRGVKVQGSLTVDCANGVGG
FT                   PKLRELMKYLTGIDIKVVNDDVINPDALNFDCGADYVKTKQRAPPSSKAAVLDRCASLD
FT                   GDADRLVYYFLDESNVFRLLDGDRIATLAASFIGDLARNAGIASKLKIGVVQTAYANGA
FT                   STDYIEKVLKLPIICTNTGVKHLHHAALRFDVGVYFEANGHGTVTFSENALKVIKNTEP
FT                   QSPAQQHALESLQALTDLINQAVGDALSDALLVEAILAHKGWSPKEWLGTYTDLPSRLV
FT                   RVEVNDRSIFKAYDAERKLESPPGLQGTIESLQSRYNKGRSFARASGTEDAVRVYAEAA
FT                   SRSEADDLATRVANAVSEAGSA"
FT   CDS_pept        join(complement(637506..637899),complement(636362..637449))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978070"
FT                   /orf_name="Pc13g02750"
FT                   /product="Pc13g02750 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91344.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001830DCD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E2"
FT                   /transl_table=1
FT                   /translation="MPITKKRKVAHAEPAAPVEDSDASSNASSSSPQPTAENPDIGDSE
FT                   PQATADDPNVKDATSETEPSATTAPKTFKELGLIDSLCEACDKMGYKAPTPIQSESIPL
FT                   ALQGRDIIGLAETGSGKTASFVLPILQALMEKPQSFFGLVLAPTRELAYQISLACESLG
FT                   ATINVRSTTLVGGMDMVPQSIALGKKPHIIVATPGRLLDHLENTKGFSLRSLKFLVMDE
FT                   ADRLLDMDFGPILDKILKVLPRERRTFLFSATLSSKVESLQRASLSNPARVSISSSKYA
FT                   TVETLQQTYLLRPYKHKDIYLVYLLHEFIGQSVIIFMRTVHETQRVAFLLRGLGFGAIP
FT                   LHGQMSQSARLGALGKFRSKSREILVATDVAARGLDIPSVDCVLNFDLPTDSKTYIHRV
FT                   GRTARAGKSGTAISFVTQYDVEIWQRIEAAMGKELAEYPAPKDEAMVFAEQVSASQRDA
FT                   IQAMKHYDEKKGAKGKGKFSFKGKRSRDAMDQEEG"
FT   CDS_pept        join(638108..638308,638359..639501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949855"
FT                   /orf_name="Pc13g02760"
FT                   /product="Pc13g02760 protein"
FT                   /protein_id="CAP91345.1"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0001830DCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E3"
FT                   /transl_table=1
FT                   /translation="MAKQRVKKRTHQKPQNASAVKGSTASMSKTPKSMVIRVGASQVGS
FT                   SVTQLVKDVRRMMEPDTAVRLKERKSNRLRDYTVMTGPLGVTHLMLFSKSATGNTNMRL
FT                   AVTPRGPTLHFKVENYSLCKDVERSMKRPKSGGQDHKTPPLLVMNNFTTPDATEESKVP
FT                   KRLETLTTTIFQSLFPPINPQNQPLSSIRRVMLLNREPAEKDSDSYILTLRHYAIATKK
FT                   TGVSKRIRRLDPKEIRNRDKKKTAVPNLGKLEDAADYLLDPSAAGYTSASETELDTDAE
FT                   VEVQESATRRVLNKREMQRQKAAEKGQDKPAHTTGVEKRAVKLVELGPRLRLRLMKVED
FT                   GVCDGKVMWHDFITKSEKEMRKMDQSWDVRRKEKEQRKKLQKENIERKKQEKAKARGSG
FT                   KEVAEEDEDEDMDDEDWLSDDDFEKDAEGEGEPADDDSEADSDESMEE"
FT   CDS_pept        join(complement(640816..640846),complement(640641..640763),
FT                   complement(640039..640586))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000151757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949856"
FT                   /orf_name="Pc13g02770"
FT                   /product="Pc13g02770 protein"
FT                   /protein_id="CAP91346.1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0001830DCF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E4"
FT                   /transl_table=1
FT                   /translation="MFTGLVETIGTVTALEPIDTSSSGGGGTSLTISDCEEILTDAHLG
FT                   DSIAVNGTCLTVTAFDKTWFKVGCAPETLRRTNLGSLQANSNVNLERAVSADTRMGGHF
FT                   VQGHVDTVAEILSVTPDGNSLVFRLQPRDRDILRYVVEKGYVTLDGASLTVTKVVDGQD
FT                   GYWEVMLIAYTQGKVVTAAKKPGDLVNVEIDIVGKYVEKSVQGYFAGTSGGDFAILEKM
FT                   VNRIVDERLKK"
FT   CDS_pept        join(641042..641215,641274..641305,641380..641503,
FT                   641563..642067,642127..642420,642479..642690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824876"
FT                   /orf_name="Pc13g02780"
FT                   /product="Pc13g02780 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91347.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001830DD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E5"
FT                   /transl_table=1
FT                   /translation="MTVALRFQVAARRSGLSWGSNALRRTIPGRSYSSAVAADGSLPLA
FT                   GIRVLDMTRVLAGPYCTQXLGDLGADVIKVEHPVRGDDTRAWGPPYAKYEDASRKGPGE
FT                   SAYYLAVNRNKKSLGLSFQHKSGVEILHKLAKECDVLVENYLPGGLKKYGMDYETLREI
FT                   NPKLIYASITGYGQTGPYSNRAGYDVMVEAEMGLMHITGARDGAPVKVGVAVTDLTTGL
FT                   YTSNAIMAALIARGRTGRGQHIDACLSDCQVATLSNLASSALISGQKDSGRWGTAHPSI
FT                   VPYRSYKTSDGDILFGGGNDKLFGVLCDRLGFSEWKTDARFVTNSDRVQHRAEIDGMIE
FT                   STTMQKTTQEWLDIFEGSGMPYAAVNDIQGTLNHKHVLARDMVTEVEHPACGPIKLVNT
FT                   PIKYSEATPGVRTPPPTLGQHTDEILGSVLDYGEADIARLKDEGVVS"
FT   CDS_pept        643313..644860
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949857"
FT                   /orf_name="Pc13g02790"
FT                   /product="Pc13g02790 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91348.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001830DD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E9"
FT                   /transl_table=1
FT                   /translation="MRVSSAFMDLPATDINPGCPQNVHEGNIFDHEGVSEAIQPLPYHS
FT                   ELIAENIPWATWGSPAPLQEEAVWTTAGAMETGQQNASAALASNRTRSGRRITQPVARE
FT                   AYPVTTKEPTVTTKGPTVKAAAKKRKRLNRQVNIVCTGCYRGHSPSNNLIVLCDSCDAP
FT                   WHQRCHNPNIDNEVIEIPETNWFCIKCKPEQRQAGWRKSGKNAMKVKKVGRPKKPGVFG
FT                   SQIGGNHYTEEERRAYLSSLSHDSLVQLVVKVSNEWPSVPLFPPDMQPVTDFTLSPAIP
FT                   HNHQASKPTPKNNARSAILDWENLESMSQNANAMDSKQRISETSDATTPAATALDADKT
FT                   FAAMVSDSVPEPAPPAALGGIPAGQIFAGSSHTHAYATAPQTSTTTTPQTPSRATRRFT
FT                   SQAAPAARHARTASFVSSYSDLLTDDESSYSQSRQQSPTPSASQSSHAESQHESDYDPG
FT                   DYRAYPEAGQGFQVPLTPSDLDIMAEDKDCLTFSHSIRGPEAQNKKPYSPFGQRKQW"
FT   CDS_pept        join(complement(646151..646202),complement(645975..646002),
FT                   complement(645724..645755),complement(645487..645639),
FT                   complement(645389..645415),complement(645205..645305),
FT                   complement(645084..645119))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824877"
FT                   /orf_name="Pc13g02800"
FT                   /product="Putative uncharacterized protein Pc13g02800 "
FT                   /protein_id="CAP91349.1"
FT                   /db_xref="UniParc:UPI0001830DD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0"
FT                   /transl_table=1
FT                   /translation="MAFLYFLGTGQAFGQRASVAHRTRATGIPKGFPRAPLGRSKEPSE
FT                   PQGRNRHWTTEAICWRYDSLELKWPVTCRGTGEEGRGGGGRGEVAEGQEGTWVKNXHGD
FT                   YPEYRIGDLVYPFRRLILTSSRQAKGKRRKYEESTQSL"
FT   mat_peptide     join(complement(646151..646160),complement(645975..646002),
FT                   complement(645724..645755),complement(645487..645639),
FT                   complement(645389..645415),complement(645205..645305),
FT                   complement(645087..645119))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0 "
FT   sig_peptide     complement(646161..646202)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0 "
FT   CDS_pept        join(complement(648448..648881),complement(647618..648386),
FT                   complement(647050..647468),complement(646315..647005))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949858"
FT                   /orf_name="Pc13g02810"
FT                   /product="Pc13g02810 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91350.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0001830DD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G2"
FT                   /transl_table=1
FT                   /translation="MATSTVDEGGPVGIKKELREALDAIVSSGTFASQGRLPHVDPQIK
FT                   VQDVGAISLPLQESQLRQMMKQAHQAPYGKGSETLVDTAVRNTLELNPGQFELSNPNWD
FT                   NYIKRACTCVARDLGVDSPVSAELYKMLIYEKGAMFKPHTDTEKAPGMFATLVIGLPSP
FT                   FEGGEVAVKHQGKKMVLTTLQHGFSYVSWYSDVVHEILAVRSGYRWVLTYNLCIDPSRP
FT                   CPTACLHTDEARHLHRILKTWLNQNTAERELSHAYYRLDHEYTKANISLNALKGRDLAS
FT                   VHLLKEISNDLNMEIFLAVIAKGQMGPCRYEEPYSRKSYRSSRSYFNIYLENHNAGYRG
FT                   RSGAIHALEQIINTSYEVDTLVGLDGCEVMESMPLKNDNVLQMKCFDVDPQEDYMGYQG
FT                   NFAVVIVPRDSIAHFLKVPTERSGPYTESTCQGNKALMIGYLAKSLAHTPDDQFLIKTL
FT                   KDLCQEVWTMSETGPPGSSRPPRVVLPEAVITKVLQAAIISKDPDFVKDAVGRLERNLS
FT                   PDFFTWVQEQTAVGLITFDTIKDILLSGSIVGILSRTICSHAPAMEASDFHSLWLPFLH
FT                   HLVRFCEANSIPTSTPDYQRIFAAILKAYINNYVGERPSHDGNYVRPTVGHGCADCISL
FT                   NRFLSDPAQTVGRFSVNQKRRHHLHLRLDAAKIDCTHETERIGSPQTLVVTKSFPRHER
FT                   DSAAWGKRKAEAGVKLLDFNKRDLTGWFGEEYEGLMGMVGHGPSSGRRPAGPVPNRPTR
FT                   PRKRKAADIDVVDLRDD"
FT   CDS_pept        join(650582..651107,651273..651856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672173"
FT                   /orf_name="Pc13g02820"
FT                   /product="Pc13g02820 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91351.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830DD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G3"
FT                   /transl_table=1
FT                   /translation="MTSSTPQLLRTTAKPSHPAPGTTNSHTNFLTIDTLISILSKSLLN
FT                   PFVAWIFVLCLRAQVTPSTDPAWILAVSYATVLTVLSIARLINQRAADGVPRTVDFEHE
FT                   VVVITGGASGLGLLIAQMYSMRGASVAVLDIKAVPENSRDEIFGEGVLYITCDVADRGA
FT                   LEVAKERILQEVGTPTIVINCAAARINGLSLLDLPADAFEKTIRTNLLAAFHLYQVFLP
FT                   GIIAAESGGTLATVSSVLGQLSAAGLSDYAASKAGLSALHRTIEAEIRGNPLIKTLLVE
FT                   VGQMSTPLFDWVRAPNNFFAPVLEPVEVAREMVAAIDSGRGGVIRLPIYAKLVNWYAVL
FT                   PATVQRVARYLSGIDAAVNQSRETSGKTD"
FT   CDS_pept        join(complement(653455..653457),complement(652057..653397))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949859"
FT                   /orf_name="Pc13g02830"
FT                   /product="Pc13g02830 protein"
FT                   /protein_id="CAP91352.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001830DD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F1"
FT                   /transl_table=1
FT                   /translation="MKIKALTRSTASQQAPGSAVVRQSRNLDPTQHPFERAREYTRALN
FT                   AIKMERMFAAPFLAQMGNGHVDGVYSMAKDPGSLERFASGSGDGVVKVWDLTTQGEVWN
FT                   TQGHENMVKGLCWTPERKLLSCASDRTIKLWDPYNSSSEAPPMATYLGNSAFTSVTHHR
FT                   TLPSFAAASGVISVYDISRPSSTPSQTLHWPTSVDTITSVAFNQTETSILASTAMDRSV
FT                   IMYDLRTSQPVHKTTLRLASNAISWNPMEAFNFAVANEDHNAYLFDMRKMDRALNVLKD
FT                   HVAAVMDVDFSPTGEELVTASYDRTIRLWNRSTGHSRDIYHTKRMQRVFSATFTPDNKY
FT                   VLSGSDDGNIRLWRANASDRSGVKTARQRSKLEYDQALIKRYSHMPEIRRIKRQRHVPK
FT                   PIKKAGEIKREELNAIKRREENVRKHTKKSNLAPRTHEREKMILASEQ"
FT   CDS_pept        join(653681..653942,653997..655003)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824878"
FT                   /orf_name="Pc13g02840"
FT                   /product="Pc13g02840 protein"
FT                   /protein_id="CAP91353.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001830DD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F2"
FT                   /transl_table=1
FT                   /translation="MSFKVSPRIQEVRGLAKEDPSKAATSYQKILSEGPGSTEASSRDY
FT                   EHALIGLGEVYRDAKKPQEIADLIKTSRDTFSSFAKAKTAKLVRQLLDLISEIPNTLEL
FT                   QGNVIQSCIEWAIAERRSFLRQALQARLVAIYMQKQSYYDALTLINSLLSELKRLDDKL
FT                   MLVEVQLLESRVYHALGNQAKARAALTAARTSAASVYTPPNLQAGLDMQSGMLHAEDKD
FT                   FTTSYSYFIEALEGYSSLDESDLATATLQYMLLCKIMLNLVDDVTQLQGSKQAQKYASP
FT                   RLEAMKAVARAHANRSLEEYEKALSTYRYELGSDVFIRNHLRRLYDAMLEQNLIKVIEP
FT                   FSRVELDHIAKMVGLDTQQVERKLSQMILDKVIIGVLDQGSGCLIVYDETERDQAYDAA
FT                   LETIEKLGNVVEGLYTNQASLLE"
FT   CDS_pept        join(655342..655432,655494..656362,656415..656939)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949860"
FT                   /orf_name="Pc13g02850"
FT                   /product="Pc13g02850 protein"
FT                   /protein_id="CAP91354.1"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI0001830DD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F3"
FT                   /transl_table=1
FT                   /translation="MQAPMQQHYARAMPPNAQRSPAAPRRPPGPGGAMPVPMPQHAVAQ
FT                   QYMASRPMPHPNDAALRRSRKPTDKNLPDGIEEVIIGEGVQQYKNLRDLEKRLDAAVVR
FT                   KRLDIQDSINKTVKKYRTMRIWISNTVENQPWQGPGNNPGSGRYKVRIEGRLLDDETDP
FT                   TVPDKDEKDEDAMDHDGAQDDKAKKSESKSQSQRFSHFFKAINIDFDKPVSAIPDEVKP
FT                   VNWSKPNAHPNTPAPPNAEFDSLQFSRASQDNLNVTISLVRDEVPERYKLSKELAEVLD
FT                   VEEETRSGIVLGIWDYIRAMELQEDEEKRQVRCDHRLRSIFGREQMFFPQIPESVGPHT
FT                   SPMEPIKLPYTIRVDEDFHANPTPTIYDIQVAVEDPLRTKMMALTQNPAYTSGLRQISS
FT                   LDDQVALIVQALTHSRARHSFYTALSKDPANFVRRWISSQRRDLETIMGEATRGGGEDG
FT                   SGPEFRYGSVDGPWDSEVAKEAVRYMLAKPEAAAAR"
FT   CDS_pept        join(complement(658207..658690),complement(657372..658111))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672174"
FT                   /orf_name="Pc13g02860"
FT                   /product="Pc13g02860 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91355.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI0001830DD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F4"
FT                   /transl_table=1
FT                   /translation="MLDPFPPPPEWLRSLAEPYAIRLNSPTLADHIHEVIAAFAFYLFI
FT                   HAVLSPRLSPILFARSYNKLTPRTKLNWDIHVVSLVQSVVINAAALWVMYYDEERSSMT
FT                   SGERVFGYTGACGLIQALAVGYFVYDLIVSIVHVRMFGIGMLFHAVSALWVFSLGFVIS
FT                   QRPFLNYFAPTFILYELSSPFLNIHWFLDKVNMTGSRAQWYNGMALLFSFFSCRLVWGT
FT                   WQTVVVYGDMWNALQQTWSAAAAPLSEPASVNANVFYPARDGSLCVNEACARANAEITK
FT                   FKEYTAGGVPTWLVVTYVGSNLILNFLNFFWFSKMVETVLKRFRAPAAAAEKKPGRAEK
FT                   AAQLKEDIVHDVVLEAASKLEQEETAILQGDLSSLQEQVSSGVDSGLGEELRKRKAELV
FT                   AKISLPGV"
FT   CDS_pept        join(complement(660749..661019),complement(659979..660691),
FT                   complement(659743..659908),complement(659500..659684))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(667185..669355),complement(666422..666599),
FT                   complement(661475..665896))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210117" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672175"
FT                   /orf_name="Pc13g02880"
FT                   /product="Pc13g02880 protein"
FT                   /protein_id="CAP91357.1"
FT                   /db_xref="UniParc:UPI0001830EA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F5"
FT                   /transl_table=1
FT                   /translation="MLKRGLRRWDSSDPERAPPPLPMNPRSMSPMSPATRSNVSPNIQA
FT                   VAAKFTEKPSEHAPSSYTTNPMPLKSSPERSLVKGQHHKRMQSLQPEDTRQDARTDFMN
FT                   YLENKSPERPLRATIIEAAKPRDPTKSISSPALRQDADRDMNYSLSSRYLSKPILGEST
FT                   PPSATMLALQNMQLPLEPDPPSPSKPPKLIAGPLEPQPHPTKNTSMDSLSNQLHSLTDI
FT                   ASSLQREMMNLSRRSKDNATDLVSLKAATNARDEDIRKSLKDLSSHLTNKYLDADATRF
FT                   DFSNLFKGGDGPNPKDPDSPVSKRSYSVPRMPSPNPFAFDRDSCVSPSPISDGSAALAL
FT                   LEKVLREMATKEGEERLLELVEEIKSRPAGTASDKDADNKVTTMLEEILNLVKEDPSSK
FT                   ALVRSYGVAANLDNIQSKNASPEPTRSRSMRSVDPETERALDLSNSDKGDGSSPNSDEV
FT                   MAILRSVKNSVVEGGGMTNGVKSLVRELRGEVLGMGRELGRRLDEIETSRANDQPEDQP
FT                   RAAGPEEISAIVNRSLDDLKEQLAATINESRQQSSDLSEFRSTMNSAAIYSVVKKALDE
FT                   FELPQPQAISRGAEMDREDILETVREAWETYKPEIEFNNFGLERDEILTCLEEGLKSYQ
FT                   PQHEQAVTYDQVLAAVEDGMQKFIPPQIEHPPSISRDEIILTIRECLEKQPEPASRSLD
FT                   EEHVGHLHSMRDEILDAVSKAMASHTEGSSKDSYDSGLGRDEIVSAVSDGLEAHFTAAK
FT                   EMDEPRISRHDVMNAVNEAFDAQQSAVAVASALSTNVQEPSISREEIFSAIAEGIQNGN
FT                   SITREIELNQDDLMEAITSGLNVAIGTANTNVGGEMTDRLQTLFEGMKEEFKQYSAAGG
FT                   RDTEQVLDAIKDGLDVVRKEIETYVVTAADLSGKDEVIDTVKEGFRLLQADMEKTITDT
FT                   SLLNASRGIPDTPELLDAMEKEFEHLRGTITTLLLRNNATEDKDEILDAIREVADRHKN
FT                   DSGDGVVETIKQEFETLRERMDMSMVRAEPGAEKDEIISALREHFDNLREQTSLKDGKE
FT                   NDVVNTIKQEFESLRERMEMSVVRAEPGAEKDEIISALREHFDILRDETSRRDGNESTL
FT                   SATSELLDAFTDGVGSIRDDLKKLLEKPTEFDNSEIVNAIKDGLADLKLEMDSLRGSNK
FT                   ELDDASTVRGGELMLANEPSITPDIDGLKALIAQLHDKVEAIETTPRAAEPAEDALKRS
FT                   HLDEVLLALHEVQLAMGEMSTQQSTENGDPAGKQDIEVLEQLLLSTKTQLDELVFPSPD
FT                   QVATPEHIGALETMIRDAKDSIAEFSSRVEAEAPTKSEIGTLEGLIKDIWVVLGEMKSK
FT                   AKDGEEDESEKLLKSDLQTVEAMIFEVKTQVDELKLPDVDTLPTKTDIQELSTLVCDFR
FT                   EKMEASNELTAQGFDARKVEHGGLAEKIDEAKFVVGELGDELKSKLDGSTEGLTELKQL
FT                   LEGLAITAESFTTVESIKELTDLINREFERSRGEEDAVKAEKEERDAATIVKHDETRAA
FT                   IIVELGTKIDEKISEVLAKYEDANASLHSKFSETEERDLAHTESLTSTRSLAEDIKLVI
FT                   GAMGDSVNETCERLSVDTKALIEQVDQSRQQMENMHNDVRSRQEQSQAENERAAAATDR
FT                   VESKLLEFHPRILESVQEILTIVSQHYDHSQKSAEDFKSELSALPSNLPAMLPALPPPE
FT                   SDRALAIEDTPLHSKIDDLLEHTKNNKVHEVLTTLLDHSKNDQLHEKLDRALDQASGSN
FT                   DQIYEKLNELLDHATNGNGPVHEKLDALLSRLNPPEPDHSVTQMTKLDEMHRDIMENSR
FT                   RMNEMFAAQSALIAEDTERKRREAEEAAVALERRVSQREQVEAELVGLHEEKDSMLNMI
FT                   HRLKAEKEDMIKQNNKLSKDLSGLETALEIRHEEMRQMEDRADGLEKRILEGVLDHART
FT                   VLLGRSNSVQAMNLKRNRSTRSTRSSRAGARSPSVASTASTAKEPKDSRSLLGNGVGMA
FT                   LKRMPTSLHAGTGAVQPNIGKERRILSLSHVTGNRGVDRQASVKSGITNLKRSHSVKSN
FT                   SPRKSSWAGPTSVADKENVPFHEEDEIASQAEDAVPQRKTSYAESNAPTDRKTSYAESD
FT                   LATETEHNYAPSNAGTDRRTSYAASNAGTERKTSYSGSIVDSVVADAAGQRRVSGVSST
FT                   NSYSVAESSVADHDHEDRHDDISIDGSDSEDDAQTTREDAEHSGHENQNEDHEMSRQIR
FT                   EANEAAEAEVMKLLAPPSDSGLGTDVAV"
FT   CDS_pept        join(670201..670254,670427..670972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949861"
FT                   /orf_name="Pc13g02890"
FT                   /product="Pc13g02890 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91358.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI0001830EA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F6"
FT                   /transl_table=1
FT                   /translation="MKVGRVAIITRGRYAGKKVVIIQPVDAGSKSHPFSHAIVAGIERY
FT                   PLKVTRGMGKKLVDRRSRIKPFIKVVNYNHLMPTRYTLELEGLKGTVTNDTFKEVSQRE
FT                   DAKKTIKKALEDRYTSGKNRWFFTALRTFGPGYTHICISRLDTNTPKQVSKRFTWAFCR
FT                   FERTGLGEGEVEKPSSTFGPCEHGMGKHTPWLETDS"
FT   CDS_pept        672032..672823
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978071"
FT                   /orf_name="Pc13g02900"
FT                   /product="Putative uncharacterized protein Pc13g02900 "
FT                   /protein_id="CAP91359.1"
FT                   /db_xref="UniParc:UPI0001830EA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F7"
FT                   /transl_table=1
FT                   /translation="MAIPLKTIHEDSREEWMDNEVHRHYNMPMVAVRAEPRVLMHCNVC
FT                   RDTASVQKTSVSIDKWVNTEYFIWEMSAGLADSGANPQWTELFEEQYQERWMQIQSEFE
FT                   SIADLPERFLHKVPVPPFLVAEVRIKTNKFPCHWRLRADTGRHMIDTSFWHLWKSILQQ
FT                   DSFIVGPFDVILKVPSHTPAGEDVVDPWNMSLSNDRHSAASDDFSYLRWDRAYNDSAPL
FT                   DFTCLGEGAQRDSSPPAGRRRSRSTSAIRELSQRMRDSLFL"
FT   CDS_pept        join(complement(674374..674628),complement(674072..674170))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949862"
FT                   /orf_name="Pc13g02910"
FT                   /product="Putative uncharacterized protein Pc13g02910 "
FT                   /protein_id="CAP91360.1"
FT                   /db_xref="UniParc:UPI0001830EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F8"
FT                   /transl_table=1
FT                   /translation="MTYASASTPLCESSPSARTLAMPVMYPLIGLSVGPSNRPLYSREY
FT                   VTASGPNVGGKPKALAGLEIVLPRACDGRSDSSQIHPNLGGKPKKALVVARFSDLVVGT
FT                   WKKLDMATGLDLS"
FT   CDS_pept        join(675394..675465,675553..676044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949863"
FT                   /orf_name="Pc13g02920"
FT                   /product="Pc13g02920 protein"
FT                   /protein_id="CAP91361.1"
FT                   /db_xref="UniParc:UPI0001830EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F9"
FT                   /transl_table=1
FT                   /translation="MPHAEAKMGEPVVNGEKHYSQFFDHLTSYPIISDSISYYKGNPYG
FT                   AKSLEYADQGYTRLAKPVLPYFSTPYSYVAPYIARADSLGDKGLSQIDARFPIFKEDTQ
FT                   KLRGSIYNSASLPVRVVGDVKHHVTDIYGSEYKKCGGDSVFASGKAVITTSLVLSQESL
FT                   AWVNAFLQSKKEEAKEVVNEKNSH"
FT   CDS_pept        join(676663..676876,676960..677651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949864"
FT                   /orf_name="Pc13g02930"
FT                   /product="Pc13g02930 protein"
FT                   /protein_id="CAP91362.1"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI0001830EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G0"
FT                   /transl_table=1
FT                   /translation="MVKKLVRLAIASEYSRLPIRRNDISAKVLGEQGSRQFKLVFDQAQ
FT                   REMRQRFGMEMTELPAREKVTITQRRAAQKTEKPSSANKSWIVTSTLPLPYRSSDILIP
FT                   TKAPSLYTESTYTGLYSFIIAVIVLNGGSLAEQKLDRYLSRTNAEVATPIDRTDKLLQR
FT                   LCKEGYIIKTREMDGGEEVIEYVLGPRGKIEVGTSGVAGLVRTVYGKEKGDHEGLTHLQ
FT                   REELEDFEGKLGRSLGIEPAPVRANGVDGASDVGDARVNGSAEDCEAPQSSGPRRSSRR
FT                   APTQEEDEEEDDDSEEYEEE"
FT   CDS_pept        join(complement(680142..680146),complement(679806..680074),
FT                   complement(678639..679747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824879"
FT                   /orf_name="Pc13g02940"
FT                   /product="Pc13g02940 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91363.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0001830EA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G1"
FT                   /transl_table=1
FT                   /translation="MGKEERSHLNIVVIGHVDSGKSTTTGHMIYKCGGIDQRTIEKFEK
FT                   EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMI
FT                   TGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVKQLIVALNKMDTCKWSE
FT                   ERYNEIVKETSNFIKKVGYNPKAVPFVPISGFNGDNMLEASTNCPWYKGWEKETKAGKA
FT                   TGKTLLEAIDAIEPPVRPSNKPLRLPLQDVYKISGIGTVPVGRVETGIISPGMVVTFAP
FT                   ANVTTEVKSVEMHHQQLKAGNPGDNVGFNVKNVSVKEVRRGNVASDSKNDPAAGCDSFN
FT                   AQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKATETSPKFIKSGDAA
FT                   IVKMVPSKPMCVETFTDYPPLGRFAVRDMRQTVAVGVIKSVVKNAGGAGKVTKAAAKAG
FT                   KK"
FT   CDS_pept        join(complement(681874..681883),complement(681596..681805),
FT                   complement(681414..681508),complement(681324..681359))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129242"
FT                   /orf_name="Pc13g02950"
FT                   /product="Pc13g02950 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91364.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI0001830EA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G4"
FT                   /transl_table=1
FT                   /translation="MLVFCPNCSNALTISKAESSTRFPAGVNRFECRVCPYEAPLEKNY
FT                   FEKKAMKQKEVDDVFGGKEEFANADSVATQCPAESCNGERAYFFQLQIRSADEPMTTFL
FT                   KCTSCGARWREN"
FT   CDS_pept        join(682354..682365,682424..682601,682677..683005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210161" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824880"
FT                   /orf_name="Pc13g02960"
FT                   /product="Pc13g02960 protein"
FT                   /protein_id="CAP91365.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001830EA9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G5"
FT                   /transl_table=1
FT                   /translation="MADEGASPRELVVEACRRDQPHLIEQVLNEMEEKTNEQVAQFFNE
FT                   VTDSMGNHALHVCAQYGSYDTMDALFDIQFFECDPLTRLDNDTPLHIAVRYANDKDAEL
FT                   GEAMIKMMCEAGCDPRVRNKHGQKPAELVFNNNEIKKTLQQTEYIMAEGIQNTGDGVDS
FT                   DGGEASDSD"
FT   CDS_pept        join(complement(684657..685036),complement(683264..684599))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949865"
FT                   /orf_name="Pc13g02970"
FT                   /product="Pc13g02970 protein"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP91366.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001830EAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6"
FT                   /transl_table=1
FT                   /translation="MALLSNAILATLVLTATAVLLPKLTGVLLGLVFRGVGWLIWRRTR
FT                   SRREYVIARARSEEEELRASRPKGSTLSRNGAEDEDWEKVDSSGTGGVQTTAGSGSSSG
FT                   SGNESYESPEDWDGIIGFFHPFCNAGGGGERVLWEAIRATQKRWPKAICAIYTGDHEVN
FT                   KATMLEKVENRFNIRLHAPTVVLLYLTTRKYVVSSSYPYMTLLGQSLGSLIVAYDAFTL
FT                   LVPDVFVDTMGYAFTLALCKWFFPRIPVGAYVHYPTISTDMLASLDDKSGVQGINSGAG
FT                   RGWKGKTKRRYWEIFAKLYGWVGRQVDVVMCNSSWTAAHIRTLWGTGKKINNSSGDGSP
FT                   SSPAVVFPPTAVTELQSNIVVDTDSEKTRQPVLLYIAQFRPEKNHPLVLRSFARFLQER
FT                   TNNPAYEGQPPPRLVLIGSVRHSSPDETHIYNLRLLAHELRIRDHTTFLCDASWPVMLS
FT                   HLRTASVGVNAMWNEHFGICVVEYQAAGLICVTHDSGGPREDIVVDLGDGATGFRAETE
FT                   EQFAASFEAALALPEAEKLAMRQRARRSAQRFTEEEFSRKWLDQVQKLVKASTV"
FT   mat_peptide     join(complement(684657..684982),complement(683267..684599))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6 "
FT   sig_peptide     complement(684983..685036)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6 "
FT   CDS_pept        685294..686331
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978072"
FT                   /orf_name="Pc13g02980"
FT                   /product="Pc13g02980 protein"
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91367.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI0001830EAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H202"
FT                   /transl_table=1
FT                   /translation="MYALRSSQTIQLTRRAIQLPRSQVRYFHPTRPASFSVVGLALDSS
FT                   TAFIHGVHTVSCLPWVASIPLTAVLIRTFVGLPILLYTRLHRHREMKIVPILSAWMKRY
FT                   AQKQMDQVPTANLRNYNNTEVKRNILTELRKRTAVLHKRWGVSSKYKAIGFLQIPVFIA
FT                   LMESLRGMSGNNSGIIAWLSSFIESSQDPASTAQPLHLTIEPTLANEGALWFPDLLAGD
FT                   PTGVLPLCLTASILGNVLMGWKVKPWKEIALLPKIEMYKQTLFTGLRSFVIVLTCYIGF
FT                   ASFVQGMPTALMLYWITSTNVATLQTWVLDKKVFSPPGFKRFVEKSIAFEKPGVEDPFQ
FT                   LKNLR"
FT   CDS_pept        join(complement(688430..689094),complement(687357..688376),
FT                   complement(687188..687299))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949866"
FT                   /orf_name="Pc13g02990"
FT                   /product="Pc13g02990 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91368.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001830EAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H203"
FT                   /transl_table=1
FT                   /translation="MRQATVQACRTARRAPVWNIAAKRPCPLTFNQLRGIRPYSGGRRS
FT                   SHTPVAPRSSMHRRNLSLAVISTVVASGAWYTCQGDTVKSAATQIRSFASSALNSAYAE
FT                   GPAESTRRALLVSGDQFYTATLSADQPLTKHTDDSDRRVLEMLTPEQATQKLRKNEESY
FT                   LVNRGKGVVRYDVVQVPSNSPIEDDHAEKIVEIPASVSAVSDGEPSSDWMFWGVFDGHS
FT                   GWTTSAKLRNVLISYVARELNTTYKAASADPSLLMPTSEAIDAAIKKGFVRLDNDIVHE
FT                   SFKEVMKSKSRRVAAELLAPALSGSCALLSFYDSQTKDLKVAVTGDSRAVLGRRSPSGK
FT                   WTATALSEDQTGGTPSEMKRLREEHPGEPYVTKNGRILGQLEPSRAFGDAFYKWSRDVQ
FT                   DTIKAKFFGRTPHPMLKTPPYVTAEPIITTTKIDPSKGDFVVMATDGLWEMLSNEEVVG
FT                   LVGHWVEQQQSAAASTGSKAWLQSWFGFDNQKKLPVETAADGSTEGQRRPIRQQQYDIS
FT                   GAASRFVVEDKNAATHLVRNAMGGKDKDMVCALLTLPSPYSRRYRDDVTVEVIFFGQGP
FT                   DSRTVEVNQEASASEQPPKSKL"
FT   CDS_pept        join(689376..689872,689984..691544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672176"
FT                   /orf_name="Pc13g03000"
FT                   /product="Pc13g03000 protein"
FT                   /protein_id="CAP91369.1"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniParc:UPI0001830EAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H204"
FT                   /transl_table=1
FT                   /translation="MSSRAIRKLQKLREQAQQRESDQQDESSEDEAPRPAKPKFNAFDL
FT                   LNAENEDEEEDEDEAQEEPYARIPEPEPEPTPVKPKKSNKKKKKKAVKTSDPASTPPSK
FT                   SNEADLDEIDRALKDLSTGGPTSVGTGLSTRHPPEASFPKTTSELLGIEPKFLNATNEM
FT                   RRLYSPASRGQSLAGVTLRRNILMQGKDEWPRAPSGGLGMETVKKLPSGETLYRLVHNT
FT                   AYQDVQRQFDLCVESMDPQRLIGHLQYNPYHISTLLQVSEIAKHQGDHAVSADLMERAL
FT                   FNIGRSVHSSFANRLKEGEARLDFIHAENREFWLVGWRYITNLAMKGTWRTAYEWAKLL
FT                   LSLDDSDPYCMRLLIDHLALRGREYAQFVQLCTQTRFSRDWANLPNIQCSLVMAYLRLN
FT                   KPQECRRQLQLAMSHYPWIFSRLAQELDVQHVPKQIWGKMPPTGAHELLTELYIARAKD
FT                   LWNTPEAISLIMEVADSISGEEPNEPPEITLDIARHVVLSDIAKVTTHLPNHFVAGRLS
FT                   SSDPLPPYESEAYQQQSEPTPIYAAPAGGGENWLQDLLGQINHNVRPRNVESDDGEPIG
FT                   FEDEDEDEDTEHIDIPHSRPPLRDPAALEGWLTREGLQTLRIFLTQYGVDRGNWSEVVV
FT                   DYAPLTNYLEAMAAISETARQRLLDGSIKDSLGDFAVSMLEDELAIMRGE"
FT   CDS_pept        complement(691936..692937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129243"
FT                   /orf_name="Pc13g03010"
FT                   /product="Pc13g03010 protein"
FT                   /protein_id="CAP91370.1"
FT                   /db_xref="UniParc:UPI0001830F6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H205"
FT                   /transl_table=1
FT                   /translation="MTQNNATSTTNIKTRFLICSDTHGLDSLPGFIPSAEQHADVAIHC
FT                   GDLTTQSQLHEYKASIRLLQAIDAPLKLVIAGNHDFTMDIPMFHKKVADAQSLERELVE
FT                   QAYGYDGEARRLFEGTGITFLDEGVHSFHLQNGALLTVYASPYTPSLGDWGFQYHPDKG
FT                   HDFMIDNGSGTNTVDVVMTHGPPKGIMDYTHSGERAGSPDLFRALARARPRMHCFGHIH
FT                   EGWGAKLVTWRDRTTAMPSHLTDIDNGQSYPIAKLSDMKDRAEQSLSGDSAPMKYFATS
FT                   HCSEDAHPLNWGSQTLFVNAAIKGTPQGIYKQKENLSMQLPWAVDLELRSSA"
FT   CDS_pept        join(693212..693575,693660..693940,693994..694164,
FT                   694221..694535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949867"
FT                   /orf_name="Pc13g03020"
FT                   /product="Pc13g03020 protein"
FT                   /protein_id="CAP91371.1"
FT                   /db_xref="UniParc:UPI0001830F6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H206"
FT                   /transl_table=1
FT                   /translation="MASKRPRSDSPEASFSRPRRKVTEPDPPPPVPYEDSIFSVQTDVS
FT                   EFTRAANLTAMLDRIDRYTTSAERPHDEILQASLRNFLEMLPPDGCAELLKDIDSKPGD
FT                   EGLYEVFSNLYTGLRCRMMSRSKPPSITPFPNPKRGDNAEALSAKMDKPISRDRKFKTA
FT                   LLARDGYKCAVTGHFDQGRYEELGLDSPDLNPTDTQGAHIIPFSYGFWNSSQSPPPDMA
FT                   TAWEVLYRCFPALRRLRFNWEDINNLENGITMAEWIHSRFGKFRLAFEATEVPDQYDVE
FT                   IFGPIGNAYRNMIHDRITFTNHDSAKDHKLPSSILLECHYILAKILNASGMAEAFDHDF
FT                   DRWEAVKESVHSLREDGKTDIGSILGLSFLCDDIAR"
FT   CDS_pept        join(695704..695790,695843..696441,696494..696543,
FT                   696595..696653,696712..696861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949868"
FT                   /orf_name="Pc13g03030"
FT                   /product="Pc13g03030 protein"
FT                   /protein_id="CAP91372.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0001830F70"
FT                   /db_xref="UniProtKB/TrEMBL:B6H207"
FT                   /transl_table=1
FT                   /translation="MEGPIPLTAREAASGLLGSVSMTCWFFLLVPQLIENYRNGNAEAI
FT                   SLLFVFVWFIGDVANLAGGLLSRLVPVIIAIAVYFCIADGVLIAQCVYYKVRNSRPEPF
FT                   HRRRSSTETPDPTTPLLGRRFSDSLASSQSRRRSSGSLRRYHAGRRESEVEGTLAKIVE
FT                   ENDYGRKAWVKNFASVVGIFLIGMAGWTIAWQTGMWVPAPLENNNGSEEATGGLVLGYF
FT                   SAACYLGARLPQIYKNYSEKSCEGLSLLFFILSLLGNLTYGAGILCHSTEKEYFLTNLP
FT                   WLIGSLGTMVEDAVIFFQFRIYAIQEPRLSAIS"
FT   CDS_pept        join(complement(697595..697641),complement(697470..697544),
FT                   complement(697184..697319),complement(697084..697158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949869"
FT                   /orf_name="Pc13g03040"
FT                   /product="Putative uncharacterized protein Pc13g03040 "
FT                   /protein_id="CAP91373.1"
FT                   /db_xref="UniParc:UPI0001830F71"
FT                   /db_xref="UniProtKB/TrEMBL:B6H208"
FT                   /transl_table=1
FT                   /translation="METGCSVYLRVITWPRILGELKTFGTLLGLSMIKVLLWPGDAVGL
FT                   VVGGSLIRCFRSQGDLSLSAPGPYGYRSVDWSSRGLINGAKNCTDNISDVYCCSFQGYA
FT                   VATPLL"
FT   CDS_pept        join(complement(698432..698500),complement(698177..698254),
FT                   complement(697943..698072),complement(697839..697885))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949870"
FT                   /orf_name="Pc13g03050"
FT                   /product="Pc13g03050 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91374.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI0001830F72"
FT                   /db_xref="UniProtKB/TrEMBL:B6H209"
FT                   /transl_table=1
FT                   /translation="MSTAELACSYAALILADDGIEVSADKIQTLISAAKVQEVEPIWSS
FT                   IFARALEGKDIKELLTNVGSAGPAAAAPAGGAAAEAPAEAKAEEKVEEKEESDEDMGFG
FT                   LFD"
FT   mat_peptide     join(complement(698177..698251),complement(697943..698072),
FT                   complement(697842..697885))
FT                   /db_xref="UniProtKB/TrEMBL:B6H209 "
FT   sig_peptide     join(complement(698432..698500),complement(698252..698254))
FT                   /db_xref="UniProtKB/TrEMBL:B6H209 "
FT   CDS_pept        join(698964..699183,699236..699317,699372..699396,
FT                   699467..699745,699808..699974,700028..700241,
FT                   700295..700480,700528..700683)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129244"
FT                   /orf_name="Pc13g03060"
FT                   /product="Pc13g03060 protein"
FT                   /protein_id="CAP91375.1"
FT                   /db_xref="InterPro:IPR018810"
FT                   /db_xref="UniParc:UPI0001830F73"
FT                   /db_xref="UniProtKB/TrEMBL:B6H210"
FT                   /transl_table=1
FT                   /translation="MESPAIPVPLDPREQPILENLLRTRDALLLIKRDKSSYVKSRDVL
FT                   PLYEEVIAEVEKLNSVRKEQDRRLVHNRLDYVLDDCFQLISLLFLTVGKNNEAPAVYSL
FT                   ATTIQRLLDHLEEAGFYSSKDLNSVTKTLESTRETLERGRNTYSPALLTLLESRLQQCE
FT                   QSLAKLQKGLAVLAPPLAQTHETLVSILRSTSAVNTRSKFSASEVNALREQLKKIEKTT
FT                   KDGNFVDEEGNILAGQDDLKSLMHRCWRWTEIVLEREGKIDERFQDQYDRLLEIRNQLD
FT                   RLSVTQAWSLRETDLFVYQRKLDRIDEARVNGNFVDAEGQPADLHAQRTLLYLIRRSYA
FT                   YIYALLISSEPVSEALLPVYNQLQTLRRCLIEVKESGGVANSRELYPYSMKLNSIDNMR
FT                   VDGKFYVGPDIPEGQGSVNNLLAECYDLVWELRAAVVDEDGES"
FT   CDS_pept        join(complement(702043..702206),complement(701288..701852))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949871"
FT                   /orf_name="Pc13g03070"
FT                   /product="Pc13g03070 protein"
FT                   /protein_id="CAP91376.1"
FT                   /db_xref="UniParc:UPI0001830F74"
FT                   /db_xref="UniProtKB/TrEMBL:B6H211"
FT                   /transl_table=1
FT                   /translation="MGSHNTSMKLPSSAKSDNNRATKFQQTPPTYEASTQNVMEKYKKQ
FT                   VQHAKTPENLIQAGLVRRTYLDITLRWIVQRRAWCEQKAKALQIRQRDMSSQDLSRLEA
FT                   YEEQIKSLSSRYWVAHRKQWIESDKLWSPSAKRALTRQRKHKDWYLSGVLREDCANRGG
FT                   CCGRSCGCCERTRMTKVNTDRVHDRGHCTTACSCCLEAHGIDGEHLDMKGVDEVHFSRD
FT                   RDPHTMRLFRGYIFYLNGME"
FT   CDS_pept        complement(702486..703322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949872"
FT                   /orf_name="Pc13g03080"
FT                   /product="Putative uncharacterized protein Pc13g03080 "
FT                   /protein_id="CAP91377.1"
FT                   /db_xref="UniParc:UPI0001830F75"
FT                   /db_xref="UniProtKB/TrEMBL:B6H212"
FT                   /transl_table=1
FT                   /translation="MQPSERLPSYEETTKVSKALVNEFISGLEAEQSRNSFLIVLLNRR
FT                   LGIDDKCKAIEDAHRIPAIEQDTDAESVEDWLRLRGMHKLAQSVCYYVHTRHSSSNRRW
FT                   CKALIEADIEIRWIVQRMIWVHQQKRNMGPQALDGYLKSLKQKYWRVHRKLWIAEDSIS
FT                   SRSAARAFAFQRQKIDWYLSSELREDCARGGGCCGRACGCCEIPRTIDELRTEGIRNRG
FT                   HCTSACSCCLDAHELDGKNIGDETTDLQGLRFDTTFTEWLPDPHTLRLLKGYVFSI"
FT   CDS_pept        complement(704067..704969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978073"
FT                   /orf_name="Pc13g03090"
FT                   /product="Pc13g03090 protein"
FT                   /protein_id="CAP91378.1"
FT                   /db_xref="UniParc:UPI0001830F76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H213"
FT                   /transl_table=1
FT                   /translation="MQASEKLPTYEESTKSPKEILMDRLKKKIEKAQKPEDLLTHLLST
FT                   DLNVEDKATLLRQAPKRIYACYHRRSAEYVEAQLREAGYGGLALYLYWCFFWYEAQPTV
FT                   PESWIKELIELDIEERWVAQRKVCIQEKLQTLQASSERPLSFEDGAKHASQLESYEEQL
FT                   KDLNKRHWALSRKKWNNRTSITSWSFSRAYDIQRSYPQWYLSFDLISDCVGRGGCCGRS
FT                   CGCCKNSRTVGGLDDGINTRGHCTTACGCCLKAHGIEDLDVGINEEIPDLRELCFEYRS
FT                   PPLMSSHSRQLLRGYAFNI"
FT   CDS_pept        join(complement(706469..706893),complement(706267..706404),
FT                   complement(706028..706201),complement(705872..705897),
FT                   complement(705651..705760))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129245"
FT                   /orf_name="Pc13g03100"
FT                   /product="Pc13g03100 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91379.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI0001830F77"
FT                   /db_xref="UniProtKB/TrEMBL:B6H214"
FT                   /transl_table=1
FT                   /translation="KIKKILPLEYYNLAKVFLKKKLDKLPLYRPSIDXNIVLKAKVXLD
FT                   YYPLYKLSFNKLKAAKXYIIKNLDKGFIILNASLYISLILIVKKPSSRLRFYIDFRKLN
FT                   IITKKDYYLLPLINKVLXQTSKAKYFTKFNIRXSFYRIYLILGAEDLTTFRIXYRSFKY
FT                   KVILFRLINGLAIFXRFINNILXEYIDKYVVTFIDNILIYSKTLKEYHRXVREVLSYLX
FT                   KASLXVTLLKYKFTIIKTKFLRFIVSIDSIAVNLKKSGXSSYRRPYRXXKAYNPFLDSI
FT                   TSIDDLSKDIVXFXSLYIIXFNRTSYINSLPIIKXPLYSXRRSXLLYXYSIIITXYKKX
FT                   EXKLILXIVYXEXYYLSTIKITISSIXXLSIXKLYKLXSXTIKYRIRNSLLLSIYYRNR
FT                   DXSLRVLYNKIVSRFLXTINLXNTLXLSNKXTNNKRDKASSFYNSISXLNTNXERKILL
FT                   XIYYXERSYLISIIVGSX"
FT   CDS_pept        join(708277..708321,708371..710722)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949873"
FT                   /orf_name="Pc13g03110"
FT                   /product="Pc13g03110 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAP91380.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI0001830F78"
FT                   /db_xref="UniProtKB/TrEMBL:B6H215"
FT                   /transl_table=1
FT                   /translation="MVSQLVWQRVSASRGMATRLSSQRLLARGLATEASSSRMPPYPKL
FT                   VRNLEQVRRVLGSDRALTLAEKILYAHLDNAEESLLTGTNNGRDVRGKANLKLKPDRVA
FT                   MQDASAQMALLQFMSCGLPSTAVPASIHCDHMIVGERGADTDLPASIKGNSEVFDFLES
FT                   AAKRYGIEFWPPGAGIIHQSVLENYAAPGLMMLGTDSHTPNGGGLGAIAIGVGGADAVD
FT                   ALVDAPWELKAPKILGVRLEGKLSGWASPKDIILSLAGKLTVRGGTGSIIEYHGPGVET
FT                   LSCTGMATCCNMGAEVGATTSVFPFSPSMVPYLQSTHRGHVADAAAEVAAAGPSSLLRA
FT                   DTKAEYDQLVTINLSELEPHINGPFTPDFSVPLSKFADTVREKKWPETFGAGLIGSCTN
FT                   SSYEDMTRAEDLVKQATAAGLKPKADFFITPGSEQIRATLDRDQTLNTFSEAGGVVLAN
FT                   ACGPCIGQWKRTDGVPKDEDNAIFTSYNRNFPGRNDGNRRTMNFLASPELVTALAYSGS
FT                   TTFNPMTDSLTTPDGSTFKFQPPSGFDLPSAGFEEGNPNFLPTAAVPDASAEVIVSPTS
FT                   DRLAILEPFEPFPKGDLSGLQVLYKVKGQCTTDTISAAGPWLKYKGHLPNISANTLIGA
FT                   VNAATGETNVAYDEAGNKYGIPELAEAWKERGISWLVVAEDNYGEGSAREHAALQPRYL
FT                   GGRVIVSKSFARIHETNLKKQGVVPLTFANREDYDRIDACDKVDTVGLYDVLQAGGQGE
FT                   IKLRVTKQKTGEVFDVPVQHTFSQDQCAFILAGSALNLLAKKAHS"
FT   CDS_pept        join(complement(712696..713956),complement(711621..712642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978074"
FT                   /orf_name="Pc13g03120"
FT                   /product="Pc13g03120 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91381.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001830F79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U9"
FT                   /transl_table=1
FT                   /translation="MASHDQNQGTAYCPGDMKHRSVSPSPHGQQYHDPNSGGLGVDPSM
FT                   ASYSTNPSFQNPDSSIGGAEAYAYPSYLAGAPSTQTLSPPADHSYAPTINTNNLPISQS
FT                   FETSLVNQLEHSSTGLRPMQGDENFSNMLNSNHPELDFSLYQNHSPNSASTPEYDSSLL
FT                   LDPQMHQRQSINQAINPADLVSPISNPSVSSHPSSRDQQNSSPGPMSPPGSTPGAYYTP
FT                   RHSRHTSLDPATAAYLTAQPGPDWQSVMNNVSFQGHRRAPSEVSEVSSANHSPYLSQHE
FT                   FDGIENNASPSLVPQSDPSLYDNGLGMESFTLSEQHQQGISPLHSPYISPRLMPQQGGE
FT                   MVPNNSYLTQFPSAPTDMYGMPQEDMMNMNQLNNPPGDIGQASQMAPPSINVEFAPPLR
FT                   NPTVDTSKSTADFDSLSPPAMRSRVRSKSDPYHPASRSRSPATSSTSLEPRAPASPRSL
FT                   SPVGSVGSHSRSSPSSRDPSPSRSNRRLSTSSIENRNYILDLADPQRPGAAPGEPKRIQ
FT                   KHPATFQCTLCPKRFTRAYNLRSHLRTHTDERPFVCTVCGKAFARQHDRKRHEGLHSGE
FT                   KKFVCRGELSRSGQWGCGRRFARADALGRHFRSEAGRVCIKPLLDEESQERDRVLLERQ
FT                   QQQQQSPSGHLQPIPQPLVMPNMPGMDGQSTGNFVLPAALLAQYPALQTLQWDQISAVG
FT                   DDPGDIGGRSSFDASSGGEFGFDEDDSGMGGGYGNNQGGMYGVDNSGQMLGVNPGDPGY
FT                   SDQKWTG"
FT   CDS_pept        join(complement(715811..716140),complement(715019..715747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217077" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949874"
FT                   /orf_name="Pc13g03130"
FT                   /product="Pc13g03130 protein"
FT                   /function="cation binding"
FT                   /function="glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91382.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0015926"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001830F7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V0"
FT                   /transl_table=1
FT                   /translation="MLPHLLLAAAQLFASSSAALTYNGADISSLLVEEGKGVSYKNLAG
FT                   TPEKLETILSASGVNSVRQRIWVNPSDGSYDLDYNVKLAKRVQAQGMGTYLDLHYSDTW
FT                   ADPKSQTTPSGWSTTDIGILAGQVYDYTLDVCNTFAANKIDVDIVSIGNEIRNGLLWPL
FT                   GGTSNYNNIARLLHSAAWGVKDSKLATTPKIMIHLDNGWDSGAQSYFYDQVLAPGSGLV
FT                   STDFDYIGVSYYPFYNADATLAALKTSLTNLHSKYKKETLVVETNWPFSCPNPGYAFPT
FT                   DLKDIPFSVEGQQTFLQRLAKAVEEVGGLGIYYWEPAWVDNAGLGSSCDDNLFFAWSND
FT                   QARASLDTLGGL"
FT   mat_peptide     join(complement(715811..716086),complement(715022..715747))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V0 "
FT   sig_peptide     complement(716087..716140)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V0 "
FT   CDS_pept        complement(717368..720892)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129246"
FT                   /orf_name="Pc13g03140"
FT                   /product="Pc13g03140 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91383.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001830F7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V1"
FT                   /transl_table=1
FT                   /translation="MTEIRSSQAGLEDPDQLARNRHASKNHKRNLSRSDESSQVPSASN
FT                   DHPESHPPSKSSAEQPSIITDVSEATATFRQAFPGLYGARTPSNRSSSSSLQALNEGIV
FT                   VDVRSENGSIGRTTRRASRHSDHQLPVYPDQSYASLQSQVHPTWHPPYLAEPDPLPRHS
FT                   YARGIRTAGNTPVSSPGLFSMRHSRMGTPSGSDDDVSTGSSLLHPSHLQPPKETHTAEV
FT                   DRDMVTGNKTINQYEILEELGRGEHGKVKLGQHVVTKQKVAIKIVQRYSTRRRLGKLGN
FT                   PEDKVKKEVAILKKARHPNVVSLLEVIDDPNRQKVYIVLEYVENGEIVWRKKGLREIVH
FT                   VDKLRLEREKNGIPDTPAFLEESHQFIRTAQHLRRQRERARERIEAQAADAQQGPIPAW
FT                   SLEHGAESSDEEDDESGLPIRRSSSRSIAVTDDSSPSFTQDPSLSAVEGSMYGAYSDYP
FT                   FERRSSTASSSFGYAPSEPEWSAEGDDMAFVPCLTIVEARSAFRDSVLGLEYLHYQGII
FT                   HRDIKPANLLVTSTHRVKISDFGVSYLGRPMRDEEEEQVGETDATELDDARELSKTVGT
FT                   PAFYAPELCYTGDDFVETIGSIPKITGAVDVWSLGVTLYGMIFGRLPFVSDDGYSMFQT
FT                   IVKKEVFIPRKRLVPVMDEASDSNQWNLRNDDELVYEDIDDELYDLLRRLLTKDPIKRI
FT                   TLKEIKHHPWTLHGLPNPRVWIEETDPGYQSKGKRIEVSNEEVTSAVSKVPFIQRVRSN
FT                   VAKWFGSRSKDKESRKRTSSTTPSTETLSSASSNNTFGKTSRDSRRSSLRGDEEFLRPL
FT                   KIGSQGHPLAQSVTASPVDEGDWASYFDAVQPAAAKLAAANKVATPPPAVTPRPGPPRR
FT                   AKSSMSTAESSKTVKPSGSDAPSTGRPFSIIEALGPTNFGSLFSGASRRASRGSRSRRS
FT                   SPSGESGSMHADGERCSAEPSVAVSNASAHGQVRTPGLWHEEEHPAAEQLVPSHVSRRK
FT                   RSSQLEDASPAESLNLTRDALLRRRRSDIDANEGGTLRVDYAMYSTESLLLPPINPPAN
FT                   QGCPDNTNNGLATSTSATISSSSADDFTSGMSQSASHPSIPSVISNASSLSGDGYSAKG
FT                   NNLDEVPSMLRTGETLKPLRPTSLRSSEEDESRYYCDDEDEDESEDEGLVIGKRKPPPK
FT                   AAASDIPS"
FT   CDS_pept        join(723538..723702,723843..724124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824881"
FT                   /orf_name="Pc13g03150"
FT                   /product="Putative uncharacterized protein Pc13g03150 "
FT                   /protein_id="CAP91384.1"
FT                   /db_xref="UniParc:UPI0001830F7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V2"
FT                   /transl_table=1
FT                   /translation="MPKAATLKTTPLMQKSPLKLKPPVGNLEMITQPLEPSKVPRKKEH
FT                   PGQQRDFKNTRCKLRRWPRESPEERGFAWLSHLVSGYGQGTVSAKKGLARLGSPSWVPT
FT                   GGYLSALELFWGWREIPPRFSVHQSGGCIIESGYCGVDGIWRTE"
FT   CDS_pept        join(724299..724417,724513..724797,724894..724972,
FT                   725206..725272,725781..725894,725993..726087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949875"
FT                   /orf_name="Pc13g03160"
FT                   /product="Putative uncharacterized protein Pc13g03160 "
FT                   /protein_id="CAP91385.1"
FT                   /db_xref="UniParc:UPI0001830F7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V3"
FT                   /transl_table=1
FT                   /translation="MGPKIEPGKTAIYGDVAVDHRIREIGTQRQKNESMDRASMYVLRT
FT                   DPLILSFLSHGRVTFNIHTSGATPQRLVSVIKPIDLTLAPFSVFVIVRRCRVVVRAMLA
FT                   AVIELSLPYALELGIRVSWGAFFGDSGFDSGTRHVIKVFSRVSFHGPHPGWVHNKRQTL
FT                   VGEWDTISDHFDSLELNRADGDQSVLMHQDHSPDWLRTHPNAHPVLSDPSEITQPALAG
FT                   KCGVNDPSTCLLPDMVVTPARRLSHSLSAV"
FT   CDS_pept        complement(727497..728456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949876"
FT                   /orf_name="Pc13g03170"
FT                   /product="Pc13g03170 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91386.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0001831045"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V4"
FT                   /transl_table=1
FT                   /translation="MPASHRRGPWVPEEDQLLTQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKKRGLSTPTTSRTYSGRIEAPYTRASAMSPSRSRFSSSSASSSRPSWTESIESAISE
FT                   QYSHSRRESLASSARQLSPIYTLPSINRPIETPLTSPAFSEASHATSCEPPSMVSDHNS
FT                   VCSSSPRTFPSPQLLPLPVDLRSQYEIRRPSVHVVEDSPSYPARSLESLSDMASAQRWM
FT                   GHQPTLASWHQPTDLPKSYIPKPEPVRDTRMGVNNLLN"
FT   CDS_pept        join(complement(738857..740544),complement(737464..738806),
FT                   complement(736196..737085),complement(735512..736138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949877"
FT                   /orf_name="Pc13g03180"
FT                   /product="Pc13g03180 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91387.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831046"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V5"
FT                   /transl_table=1
FT                   /translation="MYPTVAPFPSVQPHQRIHYNTDTLNQQMYDANDQLPVHNDPSKPP
FT                   FNTIPRSRIPLPHPVQRLDPRDGSGYSSSTNMAEHTLRRKTPNGTLAAGYDGTLGDTVQ
FT                   PPAPKHILVSPMESGQFIPPQQGMQSENWQPMDQSATKQMNFPPVFKNDPAGNTIQGEV
FT                   VQDVNGTSWVRPVNYPPGVDSMLNQTLPLQPSQRYLLQNGQYVPTVLPATLQSCLGPTA
FT                   SAGTGPFGPYWPDGVYIPYRPAAFRDARFESPSPFTKQMSQPFYDLNQPTFNQAQVPLG
FT                   SHTDSGVAWGQSMPGLPTQDSLMKPLFPPRHSDQLPFHTRANRPLSGHPPPQSLNNEPT
FT                   NWSSRPLHGFQTPGPAVVVNADFKEKVLSEAHGVYVDLLATIHQARRNSVSNAAVDGYP
FT                   RFLKPSIYPKPPRQPGLDFSQAPPPDLTRHNSYPASQYDLQRQKFNAGSLRSNDPTSIP
FT                   RVQTRRPSLNQFAHSRGSDTHMLGLRDTGCPSGVSPFTRARGSLFNEGSPMSNAASALS
FT                   MLSDLCAESRWEWIDGMLLGGCLAYGLGDYHKAVRWYSRIITRDSTHVEAISNLAATML
FT                   ALDRREEASQHWLRAVQLRPSFFEAVEHLIGLLCNSHRGREAVNIIDFVQTSLRHPKDG
FT                   DCFKTDEHASEPESDAESNVSDACMYDKASFEYEDDMGQTQGIEPSSPDAKPLGFASSG
FT                   YAISGAENGRMLALVHAKGNMLYALGDNAGAAAAFEDAVLIAAGRRRHGIQSIIKQIFA
FT                   AFSSGPSNGYPQPEHDSKESILLYPDAALKTAKLVFPASGMPPGLQYVAEGISRNAATS
FT                   TTSNSLLSLAKIYQDGMSSVGSSGATRSSPGVRDILALYYLSLSLQPSPSTANNVGILL
FT                   AGIQNNPPARGSVRSNGETQHHLEIPGVVPGSGISLALAYYNYGLHLDSRHAHLYTNLG
FT                   SLLKDIGQLHAAIKMYEQAVQCDGNFDIALANLANAVKDSGKVNDAIVYYKRAVKVNPE
FT                   FAEAVCGLANALNSVCNWVGRDYPLSKYRRPQLPGALSAPNAPTVLPFHTFTCPLTAKQ
FT                   IRQISQRNGLRISTSTLRLPWLPATVFPPPSPPSPYLRVGYVSSDFNNHPLAHLMQSVF
FT                   GLHDPSRVKSYCYATTPSDKSVHRQQIEKEAPVFYDASGWSVDRLVQQIVGDGIHILVN
FT                   LNGYTRGARNEVFAARPAPIHMSFMGFAGTLGAEWCDYILADELSIPPETLSPGRRKTR
FT                   IGDRLLEEDNGEEVEDWVYGEKIVFTRDTFFCCDHRQSAPDASEKHVSWEEEQARRWRM
FT                   RKELFPKLSDDTIILGNFNQLYKVEPTTFRTWLRILARIPNAVLWLLRFPDTGEQNLRD
FT                   IAKAWAGEETASRIIFTDVAPKNTHIARAKILDLFLDTPECNAHTTATDVLWSGTPLLT
FT                   LPRYKYKMCSRMASSILSSALPSSEAGQRAREELIASSDEDYENKAIRLCLDLQYSGHE
FT                   GYARGRLTDIRQMLFRDRYKNKLFDTARWVRDLETAYEAVWAQWVNGEEGDIWL"
FT   CDS_pept        join(complement(744261..744264),complement(744169..744202),
FT                   complement(743642..744087),complement(743574..743587))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129247"
FT                   /orf_name="Pc13g03190"
FT                   /product="Pc13g03190 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91388.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI0001831047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V6"
FT                   /transl_table=1
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PMDEIIEIARIMRTRSMAKELRGVVLEILGTAFSVGCQVDGRSPKDVSDDVKEGEIDIP
FT                   EE"
FT   CDS_pept        join(complement(747241..747333),complement(747052..747182),
FT                   complement(746698..746992),complement(746171..746644),
FT                   complement(745023..746120),complement(744771..744964),
FT                   complement(744693..744717))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129248"
FT                   /orf_name="Pc13g03200"
FT                   /product="Pc13g03200 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAP91389.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0001831048"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V7"
FT                   /transl_table=1
FT                   /translation="MDYEALKDQWSDVEDRDGVRLSWNTFPSTRMEASRLVVPIAAVYT
FT                   PLKEKPDAPLLQYEPVTCKQPCRAVLNPYATVDVRARVWICPFCLSRNPLPPHYKDITE
FT                   NTIPPELHPQSTTIEYQLARPAPAPPIFVFVVDTCQEDDSLQAVKDSLIMSLSLLPPNA
FT                   LVGLITFGTMAQVHELGYTECAKSYVFRGNKEYTAKQVQEMLGLAGGMRPGAPQQQPAR
FT                   PPLGPAARFLMPVQQVEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLESSF
FT                   QNAGGRIMAFTSGAATEGPGHVVSPELKEPIRSHHDIDRDNIKYYKKAVKFYDALAKRA
FT                   ANNGHIVDIFAGCLDQVGLLEMKNLSNYTGGHMLLTDSFTSSQFKQSFVRVFDKDAADN
FT                   LLMGFNASLEVLTTKELKVTGLIGHAISLNKKSSSVGETECGIGNTCAWKMCGMDPSSS
FT                   YGIYFEIANQGGPAAVQPGPQRGVIQFLTYYQHSSGHYHLRVTTTARPLSGPAGDPTLA
FT                   QSFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKN
FT                   FTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDTGDSLVMIQPTLDSYSLEQEG
FT                   AQPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYHEQEGYENLKMLLDQPKE
FT                   DARDLIADRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVSSQTIFTDDVSL
FT                   QTFMDHLMKLAVSGTS"
FT   ncRNA           747704..747852
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR32"
FT                   /db_xref="Rfam:RF01247"
FT   CDS_pept        join(complement(749465..749654),complement(748862..749412),
FT                   complement(748034..748798))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949878"
FT                   /orf_name="Pc13g03210"
FT                   /product="Pc13g03210 protein"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAP91390.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0001831049"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V8"
FT                   /transl_table=1
FT                   /translation="MIRQDAHRIDPKRRAVIDPKKRQFATPTYKQQDYAHRLNIYEIPP
FT                   TAEITLEQFEQWAIDRLKILAEIEACSYRNKSPAETESYITPLLQKFLPLSSNTSSPSG
FT                   AADPRLKNERQKDHYSHFILRLAFSATEDLRRRFARAETMLFKFRFQKDDTREKRAFID
FT                   SLNLDWEPVGDFEKTEIAKNLLSSTPGLRGLEDETWYKVDWEKVPELVERRSIFLKKGK
FT                   AYVPGREQLSMIVAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYS
FT                   EGEGYVDGSPITASSIDQLAQQHFPLCMKSLHVNLRKNNHLKHFGRLQYTLFLKGIGLS
FT                   LEECILFWRQSFKGKTDDEFNSQYKYNIRHAYGEVGGDVNRRGKGYTPYSCQKILGDSN
FT                   PGIGQTHGCPYRHYSVDNLVGFLQATGVSDKEVLRGVREDVGKMRYHIACNRVFEATHK
FT                   NEIKKVKEDGSWSQTDLDTIVHPNTYFKRSYLLKQMSKAPKDA"
FT   CDS_pept        join(750313..750484,750554..751146)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950857"
FT                   /orf_name="Pc13g03220"
FT                   /product="Pc13g03220 protein"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91391.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000183104A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V9"
FT                   /transl_table=1
FT                   /translation="MSHTTKQLRKAARIILIGAPGVGKGTQSERLLARFPQLVSISSGD
FT                   LLRENVRRRTPLGLEAEAAMQSGNLVPDSMILNLISDDMKSKGWLLPPRTSSVQPTASS
FT                   SSSSLADTSSSHSIDSSASFILDGFPRTATQAATLDSLVPVNFVVHLITPPSVILARIA
FT                   SRWVHEPSGRVYNTDFHPPKVPGKDDVTGEPLTQREDDSLETWKQRLRKFEETSKSLLE
FT                   HYDRQRCLFRAEGNSSDEISPKLFAEVERRFC"
FT   CDS_pept        join(complement(752077..752466),complement(751439..751927))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825153"
FT                   /orf_name="Pc13g03230"
FT                   /product="Pc13g03230 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91392.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI000183104B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W0"
FT                   /transl_table=1
FT                   /translation="MRWPPWSSESTNDEQKQTPSSWLSSAANKPSSILDWTAFTELRTI
FT                   IPTVVLTSGILIAVRFHRRYLRRIPDAPSISSSYLRRRSIFGQVTSVGDGDNFRIFHTP
FT                   GGRMAGWGWLPWKKVPTVKKDLKDKTIHIRLAGVDAPELAHFGRPEQPFARDAHTWLTS
FT                   YLSNRRVRALVHRQDQYSRVVASVFVRRAFDFPPFRRRDVSYEMLKRGLATVYEAKIGS
FT                   EFGGDKMEKKYRKAEWWAKKRARGLWKDYRRVGSGWESPREYKNRMGMGDPLPIEKGNG
FT                   KGNGKGKIGQK"
FT   CDS_pept        752794..754293
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129519"
FT                   /orf_name="Pc13g03240"
FT                   /product="Pc13g03240 protein"
FT                   /protein_id="CAP91393.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183104C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W1"
FT                   /transl_table=1
FT                   /translation="MTRPKESHGVAFLPRELFWMILGYLEPNELVRCRRVSRAWNEAFS
FT                   NPAVLLALLKKLFPWTDEVKSLGTETSVEEQDQGRRLFDQVASRYNYLARGKPRSIQKY
FT                   RLCDDFGSSGDREWYQVQPWESHASHMRRFVDRQFSEALWTFENGLLVYPSADHQCLVL
FT                   MDLETDRQFMVPFIIRGKVVRRVRLQKSLLVVEWAEPKAFHWLNDSDGVHRHFASSFDV
FT                   TRGENQGWSITPRNEWKIMFLGHPLSERDRFFSSHSNTHYVIYIWQPNRSLYTADEDAP
FT                   IESLFVWDISKVSSYRPSLDPTGRLRDDSPGDSPSIVARFGFRDLEFFDIRQRGCPSIQ
FT                   RLEITDDAQAVEITENVSIQPQDEPPEIFGLPEPITTSIPLVGNGPHWRRHFEGVLPPY
FT                   RGNCSMQAESMELNGCIMKDPWFGIISQVTVLEPNLGFCLHFDTWTWVQNQATYLSIQT
FT                   PRSTITCDNWDFVGRGKIAGSEKYLMGENCNRELVVYRFDR"
FT   CDS_pept        join(complement(757275..757433),complement(756042..757206),
FT                   complement(755901..755934),complement(755599..755821),
FT                   complement(755386..755454))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978318"
FT                   /orf_name="Pc13g03250"
FT                   /product="Pc13g03250 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91394.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000183104D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W2"
FT                   /transl_table=1
FT                   /translation="MSTVTVATDAYAILGVERDAKLPDINIAYKRLALKLHPDKAGNSP
FT                   ATVERFRKIQDAVEVLRDEDRRRLLDEALKKKTKRHLDPEDDIPARVFKSNYNRSSKRE
FT                   HHTHDFKWSNPFAEPAWHHRQHTFSYYYSYGTSVHMDPESAESKAKRAQFEAENVQWEN
FT                   EWLGTDPEVQKARAELRKENMRARMKRDLADMAKGQDEDTKYADFDHVVEGVLDELNFG
FT                   HEDFVHVLPEENIKTCNPADTFDTFSYEYAKKSRSGADDPIHSDRASNPQSATGSDSSF
FT                   EFTTSSDSTSYTHSANGHSNFKSTVEDFESTTDNSESTTDDSNSDAEKLINSYMVGHDS
FT                   LLPVVSFLKQKLADPHGRYTLDDLGGELNGIMLEAYCGWLEEVRLSVPNASPVTVRNDP
FT                   KFCSHHGLWYKEFGRPVCNVCNLWMPTFILTCPGCGLNACVRYFPLVWISRCCRKKKKE
FT                   RGKAASITVDSAFAHSIDFNESRSRYHFVLMHRYSDLGLTSNSHRLLILSYVPSPLTGW
FT                   TPVFVLYLARIQDPDCHYDADVVELNPRKKYN"
FT   CDS_pept        join(complement(759468..759523),complement(758753..759327),
FT                   complement(758528..758696),complement(758380..758473))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950858"
FT                   /orf_name="Pc13g03260"
FT                   /product="Pc13g03260 protein"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAP91395.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI000183104E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W3"
FT                   /transl_table=1
FT                   /translation="MFSRAVRPALRAGGAAVARPAPANAATFATLREIEGRLKSIKNIE
FT                   KITNTMKIVASTRLTRAQKAMDESRVYGKTSNTVFEQAETKPLEDKKVLLVVASSDKGL
FT                   CGGIHSGLSKATRRILADTPNADVAILGEKAKATLSRLAPEHIVLSFANVCKDIPTFAD
FT                   AQAIADQIALLPEDYASVRIIYNSFVNAQSYEPVTIEAYSEEAITQSANISSYEVDDEV
FT                   LTSLREYALANNLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQATIT
FT                   GELVEIITGATASEDM"
FT   mat_peptide     join(complement(758753..759308),complement(758528..758696),
FT                   complement(758383..758473))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W3 "
FT   sig_peptide     join(complement(759468..759523),complement(759309..759327))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W3 "
FT   CDS_pept        join(760100..760154,760379..760605,760692..762176,
FT                   762227..762469,762535..762984,763040..763174)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978319"
FT                   /orf_name="Pc13g03270"
FT                   /product="Pc13g03270 protein"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAP91396.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI000183104F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W4"
FT                   /transl_table=1
FT                   /translation="MSSSEDDAPLMRANGRVKVSPKSPEVVKMADSSPATNGHVDPGIS
FT                   IRFGPVEDKDVKMEDGEDALGAGKRKSRTSVGEKKSYAEAESSEEDEPLSKRRRTSVKH
FT                   EDPETDDDVPLARNGRKLPKPAETSIGDESDSDVPIERKLAVQKKKIEQTAEAKPSRKP
FT                   AAPKKEAKPAAAKKQTNGVKKEPAASKAAPKKGKAKVKEESQDAEEKDEEEEEEYRWWE
FT                   DQSKGDGTIKWTTLEHNGVVFPPEYELLPQNVKMKYDGIPITLAPEAEEVASFFGTMLN
FT                   STHNVENPVFQKNFFSDFKDVIKKSGGAKDSKGNKVDIKEFAKCDFKPIFEFYDAQREE
FT                   KRHLPPAEKKAAKALKDEQEAPYQYCIWDGRKQKVGNFRVEPPSLFRGRGEHPKTGRVK
FT                   TRVQPEQITINIGKDAKVPPPPPGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANS
FT                   DVKGQSDFKKFEKARELKKHIEKIRKDYQKNLKHDMMVERQKATAVYLIDQFALRAGNE
FT                   KGEDEAETVGCCSLKYENVTLKPPNTVVFDFLGKDSIRFYDEVQVDLQVFKNLKIFKKA
FT                   PKKNGDEIFDRLTTSALNKHLANYMPGLTAKVFRTYNASYTMGCVLNEMNASGGTIAEK
FT                   VKAYNDANRKVAILCNHKRTVTAGHANAMEKMGERIKGLRYQKWRLKQQMLDLDPTLKK
FT                   KKGAAFFEIDEDLDKEWIEEHQAFLIEEQRNKINKKFEKDNEKRVADGEKEMKVSELEE
FT                   RLQAVKELEKKFKKENKTGKVEAEARGATVEKLENSINKIDQRVETMSVQAQDKEDNKE
FT                   VALGTSKINYIDPRLTVVFSKKYDVPIEKFFSKALREKFEWAIKSVDEDWEF"
FT   CDS_pept        join(complement(765624..765669),complement(765405..765566),
FT                   complement(764418..765334))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978320"
FT                   /orf_name="Pc13g03280"
FT                   /product="Pc13g03280 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91397.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831050"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5"
FT                   /transl_table=1
FT                   /translation="MADAKKPAVLIVGGLGFIGRHLALYIHENNLASEVRLVDKVLPQL
FT                   AWLAPEFEEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGESRHSQPDDVYE
FT                   VRSYALSVALGKEIARRGIPAFIETSTAHVYKGGSTPRKETDKLAPWHKLAAWKLKAAE
FT                   ELLKVPNLQYCALRLPHVYGAYDPGYFATGICLSAVHVDLKQDLEFLHTKDLKINTLHV
FT                   KDAASALFEAAKWRAAKGFIDPKEGVVTFNVVDHNDTKQEHVANALTEVFGLKVSFIGS
FT                   LASQLAKLNLDDVLDDMNEVGLQTWAELVERANITRPGPISPFLERDIVRDQDMSIDGS
FT                   KFENETGWKPSYPNFGADSIREIVDSYKRMGWWP"
FT   mat_peptide     join(complement(765405..765543),complement(764421..765334))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5 "
FT   sig_peptide     join(complement(765624..765669),complement(765544..765566))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5 "
FT   CDS_pept        join(766436..766624,766744..766835,766931..767018,
FT                   767108..767185,767291..767461,767565..767630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950859"
FT                   /orf_name="Pc13g03290"
FT                   /product="Putative uncharacterized protein Pc13g03290 "
FT                   /protein_id="CAP91398.1"
FT                   /db_xref="UniParc:UPI0001831051"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W6"
FT                   /transl_table=1
FT                   /translation="MGYSEGSGCKDPRTGLQALHPIQKDGEGWDKGGALVGGPRAILRA
FT                   RHTIERRGNRQKTMSGLSSLVISGTFKSPYTDGYISSISSPGLYEPGGRMSGCGYSKAM
FT                   QPLSWSAIYQGCRHDQANFLQAGLYSPIFHFSLMGSGKVAVDGPWSHSSGGWLDWLNNE
FT                   QTIGTDTRGNIHWVTEGYLCKKNEKLAQRARVSASGGSGELRKSSTGLHPDPIRFPVYW
FT                   TIGDM"
FT   CDS_pept        join(complement(769716..769875),complement(769376..769661),
FT                   complement(768198..769323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825154"
FT                   /orf_name="Pc13g03300"
FT                   /product="Pc13g03300 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91399.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830442"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W7"
FT                   /transl_table=1
FT                   /translation="MAIEDDEKNDQHGTDIASTVSADIVPIDMSEHGTMKRALKPRHSQ
FT                   MIALGGCVGTGLFVGTGATLALGGPAFLLTAFIVLIFLVYIIVTAIVEMVAYLPVGGAS
FT                   LSYYGTRYVSKSLGFAMGWLYVYSLGILVPYEITAGALVIDYWDSPVNVAVWITVFMVL
FT                   IVGLNLLPVEYYGESEFWFSTIKVFTIIGLLVLSIVLFWGGGPKQSGILGFHYWKDPGP
FT                   INTWLADGAGGRLVAFVRTLVLSAFPFTFSPELLIATSGEMQNPRKDLGKAANRFVIRL
FT                   IVFYLGTVLAIGVICPSNDEDLVSSGSNAKASAFVVGIKHAGIHGLGSVVNAAILTTAW
FT                   SAGNAYLYMSSRALYALAISGQAPKIFLRCTNRGVPYAAVLACSSFGVLAYLNCASSSS
FT                   TVFTWFVNITNTSAFISWVCCCIVYLRFRSAYNTQGKPELPYRSWTQPYGAWFALFFFL
FT                   LLTLINGFNVFFPGQLSASSFFTAYIGIPAFMVTYAGHKLLKGRSDPLWITSDEINIWD
FT                   GLENIH"
FT   CDS_pept        770662..772047
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950860"
FT                   /orf_name="Pc13g03310"
FT                   /product="Pc13g03310 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="CAP91400.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI0001830443"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W8"
FT                   /transl_table=1
FT                   /translation="MAILKKPQPFKKALHFSEKEFEERQQRALKLMKQEGLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHKDGSKKLVTRMPDLRQALYTSVLTYNDIMIRSDDAD
FT                   SNPVSLVPLVLKEFGINSSSKRIGYEPNSATLTLEVGKLLEESVAGLCTLVNHSNLFTR
FT                   ELRIVKSPAELRKIRKAAYLADFALIRTLKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSTIERQLTLEHAGVYKHYHACLMRTVHIGGVTALARRMFE
FT                   VNILQMEAAMAALKPGCAIEEVFEAYARVADENGFKDQRFNACGYSLGATFAPTWMDFP
FT                   MFVRGQKVIAQPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVSLSKLPFHITRKQT
FT                   IAAWKKVKKEDYGFTAEEEDKGENLRDVELSDGDVDAEDYDVEYDFSEYQPSAPPGDPT
FT                   QLV"
FT   CDS_pept        complement(772327..773511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978321"
FT                   /orf_name="Pc13g03320"
FT                   /product="Pc13g03320 protein"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="metal ion binding"
FT                   /function="metallopeptidase activity"
FT                   /function="succinyl-diaminopimelate desuccinylase activity "
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91401.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0009014"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI0001830444"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W9"
FT                   /transl_table=1
FT                   /translation="MDGLQYTTKHDVTIDDVVSLTQTMVQIDSSTPGSGSNTAGETTVA
FT                   QYICAWLQHRNIECHWIEETPGRPSVIGVVRGSGDGKSLMFNGHTDTVTLQGYDGDPLS
FT                   GHIANGRLYGRGSADMKSGMAAAMIATASAAKLNLRGDVILAAVADEECDSIGTEQVLA
FT                   AGWRADAAIVAEPTDFAIINAHKGYVLLEVDIHGIAAHGSRPDLGVDAICKAGYFLVEL
FT                   DRYSQSLPQRSPTGVEIDAPNVHVGIIRGGAEINSYPAKCTISIERRTVAGETATSVEN
FT                   ELRPILQKLASTVSDFTFELRTTCYRPPYSIASDHPFVNLVVEHAVKSTGMAPPIKSET
FT                   YWTDMALLSEAGIPGVIWGPKGCGLHSKEESVEVESIRQLADSFIAIAASYCQG"
FT   CDS_pept        join(773968..774038,774091..775291,775343..776188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129520"
FT                   /orf_name="Pc13g03330"
FT                   /product="Pc13g03330 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91402.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0001830445"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X0"
FT                   /transl_table=1
FT                   /translation="MAKLVWDLDGRQRTKPVKSISYTGCWTCRKRRIKCDERPIGCKTC
FT                   EQAKLTCAGYDVRLVWNAGPNTSRRRIRSGPYGNLRVAYPCAGEADTDGRGLDRGSCAP
FT                   MTDSEVTRALTTVEKSATCPAVTTTVGPFSVFQTQSASTRDIDHPSSPNPGDTAMGGSE
FT                   ETNQPTTNSPIIPMVDSPYQTTSELPQFPESTVDTTVPPSDVCVGGDQAETPIGTLATE
FT                   SPDDAPVVNTRTSTTTSLSNLPDYLCPTSHEIATTPRGVDVTVSQSPGWMERNDHSPWE
FT                   SAPGDLGVILFENDMALAIMEDTTAAMLMHHYMQHVVHLMQPVSHPRNPWKTVYLPLAL
FT                   HGSSQLDLPKSWNQLHSASVAVFHGVLSIAAVNLQSMEADQESLERLACHHKQRALVAL
FT                   QSTLATKSTPYKGIMAAILSLVSADIMDGGMSDHWIHLEAGIKLQASRHYAMLVSHETC
FT                   LLNNICKMLHLFGQTTLPHRTPKPWPGYDYIPRGADFYSLEPSIEFLYGITISIAGAIF
FT                   RIYRLSQYVAYYRSQGQEYPETLLEACETLADDLGSYTITSELFSTIDSSEAEAYMVDI
FT                   ARAQAKAFHNAALIYYYRSIQECARSCLHQEQQAVLAAMNEAEDLKVSFGKHTSFPAPI
FT                   TWPAFVASCEAVGEERRSWDKWWRRLEVYGMRNYHRQYATVRSIWGKLGEDETRDWREV
FT                   LDTVGLRILPV"
FT   CDS_pept        join(complement(778085..778108),complement(777940..778027),
FT                   complement(776623..777867),complement(776417..776562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672454"
FT                   /orf_name="Pc13g03340"
FT                   /product="Pc13g03340 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91403.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0001830446"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X1"
FT                   /transl_table=1
FT                   /translation="MSRALPFTLDTPSLLHKASLLDGNWVQSKSGQRFDVEDPGTGKAF
FT                   ASCPTNTVADVDAYIKSAQRSFLTYRATNPRERAKMLLNWHSLVTRSKNDIATLVVYET
FT                   GKPMAEALGEVEYALGFAWWFAGEAERIRGSIAQPSISDRRNLVIKQPIGVCVALVPWN
FT                   FPVAMIIRKAAAALAAGCTIVIKPSPETPLSVLALADLALQAGFPPGAMNVLSTDSAHT
FT                   PSVSEALCKHQLVRKVTFTGSTTVGQLIARHCSEGLKKVTLELGGNCPFIVFDDGDLDQ
FT                   ALAALMVLKWRTAGQACTHANRVYVQSGVYDRFLSMLVDATRRLRVGHGADPETTIGAL
FT                   TTKSGLVKLERHIADAVAKGGKIVLGGRPLEHLGGNFFQPTIISGMSSDMLTTQEEVFG
FT                   PLLGLYQFETEEEAVRLANDTNMGLASYFFTKDVSRTWRLLESLEAGMIGMNTGNSSAA
FT                   ESPFGGIKASGYGKEAGKEVAIEEYLIAKTGTLTVGAIASKL"
FT   CDS_pept        join(778711..778752,778832..779263,779315..780871)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950861"
FT                   /orf_name="Pc13g03350"
FT                   /product="Pc13g03350 protein"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91404.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI0001830447"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y2"
FT                   /transl_table=1
FT                   /translation="MHPFDPLSPAEISEVTAIVRTHFPGQLPVFRFITLKEPAKLEMLP
FT                   FLENEHRGLPNITRPARTSRVQVVMRSDKGENQLIELLVDLDNKRVIKNEHLVGRHSYI
FT                   DADYMRLVESACLADPKVQDEIKKLKLPANSTVIVEPWAYGTDGINDMSERISMCWFYL
FT                   RLLDNPDANYYAYPLDLCAEVSEELKVTKIYYLPSSQEERISDQARPFDINRIHSTVDS
FT                   EYHPSLRPPPRNTTKPYQVVQPEGPSFSTQGNRISWEKWTMRVGFNYREGLTLHDIRYD
FT                   GRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGSDGAGVNANNLRLGCDCLGLIKYFDA
FT                   WHNTSSGEPLKLPNVVCCHEQDDGILWKHTNFRTQNAVVARARILVLQTIITVSNYEYI
FT                   FAFQFSQDASIHYEVRATGILSTCPINIGDKVPYGTIVAPGVLAPYHQHLFCLRMDPWV
FT                   DGNVQNTLQVEESHAMPISDTNPFGVGYTTSSNNITEETGLDLDISKNRTFKIINEHSI
FT                   NPITGTPVGFKLLPSYSQMLLAHPDSYHAHRSEYAAHAVWVTRYDDEEMFPAGRHTMQS
FT                   TGGEGIHSAITRRKNDGSKTSVRNEDIVLWHTFGSTHNPRIEDWPVMPMDRMVVGIKPV
FT                   NFFTGNPGLDVPPSTQERNRSVLVNGDSDSLKSSSDTCCRL"
FT   CDS_pept        join(complement(782581..782683),complement(782413..782513),
FT                   complement(782208..782335),complement(781313..782156))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950862"
FT                   /orf_name="Pc13g03360"
FT                   /product="Pc13g03360 protein"
FT                   /protein_id="CAP91405.1"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI0001830448"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y3"
FT                   /transl_table=1
FT                   /translation="MASNIPAGLRSADIGRFAIRATQIEKAKPVVAYWCNFHIVNQIIE
FT                   RGLHNTDDEIKLYTTNLVDKLEQFKLENPDNDTVTDTVAASAYVEQFGLEVFSRAEAAM
FT                   DANKVTKQTADTFQAAATFLELCSIWGPLDPEIAGRIKFAKFHAVRIVKAFKAGEDPNA
FT                   TNPAPKQEEEPVDDPDVQAFDESVAEQASKPRQASIEEVPDESDRFARELARKSTVDES
FT                   LHPSRTSSTPRPPPEIPSVPRNAPGAPPQSMDVDESNTGGLNLPSTPAAIGASSSVPKL
FT                   PDTPTAFQSFPPPSEGPSVSTPDPASFYDTPGASAPIPPPTAPAFVPTPAANVPVAPSP
FT                   YVPPQPSHGLDDNTVQMAQKHARWAVSALTFDDVDTAIKELRSSLKCLGAS"
FT   CDS_pept        join(complement(785542..785586),complement(785118..785488),
FT                   complement(784837..785068),complement(782880..784784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825155"
FT                   /orf_name="Pc13g03370"
FT                   /product="Pc13g03370 protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91406.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI0001830449"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y4"
FT                   /transl_table=1
FT                   /translation="MSRPASTQSLISQARSAEEAIAAATSKKAALEAAINAAEHYMKAL
FT                   RLAPADDKKLLDAKCKELISKAEKIKAATDWQSAARAGPQKAFPSLRPPASTRKLTTRE
FT                   EIIILEGAKLNGYIFPPWSRAPPQDEFVYKGQLFTDTPDLHLSECQREIFAGWKRPHDL
FT                   LQTMNTAKQPYDIINPAMSASGETDLVQDVLTDCSVVASLCATTARSERGLGQHASPTL
FT                   YPCSEDKNPILSHSGKYIFRFYFNGSFRKVVIDDRLPSSKTTRSLHVIDRNNSNFLWPA
FT                   LVEKAYLKVRGGYDFPGSNSGTDLWVLTGWIPEQVFLHHDDSTSDEIWGRLYSAFWHGD
FT                   VVLTIGTGKLTELEQQGLGLVSEHDYAILDLKEVQGRRQFLLKNPWAGAEPHIQSSLTA
FT                   DLGSLGLNDKPPLSPGTFWMDCEQVLQNFENLYLNWNPGLFKYREDIHFTWDLSHGRVI
FT                   AGCFVKNPQFSISSDSGGTVWLLLGKHFKTDHQEFDTGESENETGFISIYIFQADGRRV
FT                   SLSDGALHRGPYVDSPNTLMRLEMPPKSTYTAVVSEQSLPSSAQNFTLSAFSTAPVAVA
FT                   PSLDKYLCLTKASGSWTAMTAGGNAESPRYHSNPQFSIRISEPTDVSILLETTEAELAT
FT                   HVKIFWSNGQRVSRVRSRDIIADSGDYRRGCALAETKSLDKGTYTIVCSTFAPDQFGRF
FT                   TLWISSTIPCVVQPLVSESAGRRAVLSEVGVLSPGKDRMLASLRVSRLTRIRLIARNKR
FT                   STVGLRAVAPSPVLMTVELGQGPYKEILATSEDGAHSDAASGVRVEDFDLLPSAESRRV
FT                   WIVIERIGGPGGQVEDHFEVEALAEERVEIGKWVIEDE"
FT   CDS_pept        join(786153..786253,786317..786861,786915..787152,
FT                   787203..787326)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129521"
FT                   /orf_name="Pc13g03380"
FT                   /product="Pc13g03380 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91407.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000183044A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5"
FT                   /transl_table=1
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANAMVYPLDLVKTKLQVQVKE
FT                   KNGTVRPDNLEHYESTMDAITKIVEKEGYNGLYSGMAGALLGVASTNFAYFYWYSVVRT
FT                   LYMASAKPTQAPGTAIELSLGAVSGAVAQLFTIPVAVITTRQQTQPKGEKKGLIETGRE
FT                   VVDSEDGWSGLWRGLKASLILVVNPAITYGAYQRLKDVIFPGKNNLKPWEAFLLGAMSK
FT                   ALATIATQPLIVAKVGLQSRPPPSRNGKPFKTFGEVMKHIVDNEGLFSLFKGIGPQILK
FT                   GLLVQGLLMMTKERMELLFIVLFAYLKNIKKDKLRKAVDAAAEKAKTSMPATLK"
FT   sig_peptide     786153..786233
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5 "
FT   mat_peptide     join(786234..786253,786317..786861,786915..787152,
FT                   787203..787323)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5 "
FT   CDS_pept        complement(788624..788947)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(790558..791167),complement(790311..790504))
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15950863"
FT                   /orf_name="Pc13g03400"
FT                   /product="Pc13g03400 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91409.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183044B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z1"
FT                   /transl_table=1
FT                   /translation="MSSYAITGASKGIGREFVRQLAADTTNTVLAIVRDPESPYISELA
FT                   SKHHNVHVIKGDVTDPKSILEAASAAAAITGGKLDVLIHNSNAVDMATMSFNPTEIPFD
FT                   AQAVRAIFDPPLSTGIYGSLWTTNAFLPLIEKGIQKKIVHISSAMADLDLINKTGVSYA
FT                   VAYSVAKAGMNVQVAKYAAELGPRGIKVLALSPGWVDTWEGEKPSQVVEAEKVMLKQFQ
FT                   AAEPELKGQIQPEESVRKCLQVIERLDAETSGLLLSHNGDKQRWL"
FT   CDS_pept        join(791379..791551,791596..792291,792341..792639,
FT                   792670..793325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672455"
FT                   /orf_name="Pc13g03410"
FT                   /product="Pc13g03410 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91410.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183044C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z2"
FT                   /transl_table=1
FT                   /translation="MSATISAVKRRACVACTAAKAKCTPQTVNLCQRCARLGKSCTYLD
FT                   LPQTKRKRKAAPRCSRVEMLEKKVDQLTSQLTALTRQHGQTLPDTSTSNPPTNDLNSSH
FT                   DPELDSTDISELLDAAKDPSHGLDPPTSSVLEGQPSIVDRGLLSEAETERLVATFQFDL
FT                   VPKFPFVLLAHGETAVRLRNREPFLFLCIVAATIGSAHPLRKTVAEEIMNHVTSRIVAR
FT                   SERNLELLRGLLIHCAWYSYPAERYHPRLLLLAQLCVSISYDLGLHRKRSPSLDEERAL
FT                   LGTYWLSVGICGTLGRPINMKHDFRTHVCVESIAATEHLSDRWITPFIQLQSFLATMDE
FT                   VYASIEASGGSALIQVTRGSLQRQFDSVRASVEKDLSSYPSSTGVSWIPKNAIYTEIKY
FT                   VEMRLEELSLREELWIAEPESAVRTTMLMGAIQRSKELIHTVTNLPPSEIAHMTITTSA
FT                   RICAAVGYIPTAVLTLLNLITGRTDSTTEAQVQAVVDAAEYPNLVTELANALETKFEGM
FT                   SAADKETDIVGSLCSKMRLLARCYPYQIRTIVGSVPSQDARQDTSISAVHPNEVTITPQ
FT                   AWPSIYGDLGDVFPVEDIQWDSILSSFTGFS"
FT   CDS_pept        join(794204..794350,794405..794412,794448..795810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950864"
FT                   /orf_name="Pc13g03420"
FT                   /product="Pc13g03420 protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91411.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000183044D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3"
FT                   /transl_table=1
FT                   /translation="MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANS
FT                   NYTSIVDSLPPQPSLTHPLRFYAPWCGHCKNLKPAYEKAAKNLDGLAKVAAINCDDDEN
FT                   KPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRATDK
FT                   DLDKWLGQNEDRPKAILFTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTE
FT                   FPTLVLIPSADAEPKIYAGDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASK
FT                   PTSVVDDAEDLKPTASQDQDETDPSEKPVQVPIPAPPIPTLATPESVESACLTPKSGTC
FT                   VLVILPETSEPDAALPAHATEALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREA
FT                   LELADGQTVEIIALNARRGWWRRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVV
FT                   SVEAETESEAEVKPEAEAEVEPEAETVEAEAETKAETEEQAAEHDEL"
FT   sig_peptide     794204..794263
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3 "
FT   mat_peptide     join(794264..794350,794405..794412,794448..795807)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3 "
FT   CDS_pept        join(complement(796333..799307),complement(796139..796271))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950865"
FT                   /orf_name="Pc13g03430"
FT                   /product="Pc13g03430 protein"
FT                   /protein_id="CAP91412.1"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI000183050F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z4"
FT                   /transl_table=1
FT                   /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDHAKDVIVHLHYIMS
FT                   SVDVKQNKSVLWAYKKDLLGFTSHRKKREMKIKKEVKRGIREPNQEDPFELFITLNQIR
FT                   YVYYKETEKILGNTYGMCVLQDFEAMTPNLLARTVETVEGGGLVILLLKSMTSLKQLYT
FT                   MSMDIHSRYRTEAHDDVVARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPAP
FT                   ETTDESASGTKKELKEIKESLADSKPVGPLLSLARTVDQAKALLTFVDAIAEKTLKSTV
FT                   TLTAGRGRGKSAALGVAIAAAVAHGYSNIFITSPSPENLKTLFEFIFKGFDALGYLDHV
FT                   DYTILQSTNPDFNKAVVRVNIHRNHRQTIQYIQPQDAQVLGQAELLVIDEAAAIPLPLV
FT                   RKLMGPYLVFMSSTINGYEGTGRSLSLKLIQQLREQSRTGVKTDDTDIADRSTGKSAKG
FT                   ADKNLSGRTLREITLSEPIRYAPGDSVEKWLNKVLCLDATLPKSHMNTQGCPHPSQCQL
FT                   LQVNRDTLFSFHPVSEKFLQQMMALYVASHYKNTPNDLQLMSDAPAHQLYVLVPPIDEG
FT                   ATKLPEPLCVIQVALEGRISRQSVLNSLSRGQRAGGDLIPWLVSQQFQDENFASLSGAR
FT                   IVRIATNPEYVGMGYGSRAMQLLVDFFEGKFTNLEEENIAAEEQMVRVTDEELASSSLL
FT                   DDNVHVRDIRSMPPLFGKLTERRPDVLDYVGVSYGLTPSLHKFWKRGSFVPVYLRQTPN
FT                   ELTGEHSCVMVRTLSTGEADDAWLSAYARDFHKRFLSLMSYQFGQFPSVLSLSICEAAN
FT                   SGAKKDPTFKPRTLQKADLDAAFSPFDLKRLDSYANNLLDYHVILDLVPALSDYYFANR
FT                   LDGKVSLSGVQQSILLAIGLQHKSLDDLEKELNLPSSQLLAMFLKIVRKVSTHFRNLIE
FT                   NEIEQSLPAQKVRVETSAAHDDEPEVNLQPLPISLEDELREGSKKIDEEMLAKQRALSA
FT                   ANPDGPDGSKSSKRKKIETARDIYDKEIDSKRQKMIKKGTEGRKKR"
FT   CDS_pept        join(800677..800720,800787..800845,800908..801227,
FT                   801292..801705,801760..801912,801967..802391,8
FT                   02443..804015)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950866"
FT                   /orf_name="Pc13g03440"
FT                   /product="Pc13g03440 protein"
FT                   /protein_id="CAP91413.1"
FT                   /db_xref="UniParc:UPI0001830510"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5"
FT                   /transl_table=1
FT                   /translation="MIQLSSDLGLKLCVGIFLLSSLFLTTSYNTTYAFDRPISTSVLVC
FT                   FLTGLTLLVWSRFVSVGSSPSSPTSKRPAIPLAEQFELPSRASTSSFALGDVETRPRAR
FT                   FQPWWIKLALLLGLCGLRIESFRQVTRNTECAPAGYAYAIPFVISLYDYWRNHRSRQVD
FT                   RYVPTQRFEKLPLQVVYSVSRRSFYYLTQSRFRGLIAAAFLSIGGLFASSFSAGTRSTY
FT                   VCPIVLHSASRLRSYRLFNLFADSIILIGITELCQIGAQFDDARRKRALTFLGTGLLGL
FT                   SLVWSVISFWVPDSSPELAGQPMLDLEYSRGAFSQSVLVVILVLSAWHMLPHFDILGVS
FT                   IIGGFVIVYFSSLSALTEPSPFPFISLTHAVLPLAASLTGTLLFLLARVVHDEEPKLYR
FT                   TNVAIQILFAVLFGISLVFAVSKHRLEDMHPIEFLISNGQIQHHNYVAQAAKSKTLGDA
FT                   VTEYRRRYNQHPPPGFDEWYRYATSRSSAIIDDFDQIYHDLLPFRALAPEHIRAMTHEL
FT                   ATNPFNDLGGIRIRNGTAMVQEGIKPTHAWMVAGAADMMKDFAKYLPDMDLVFNLNDEP
FT                   RVAVPWEKISMLNRQTGMQEMISENRVVQTWSTNREEGWAPIEPADQTNITVFTDGAWR
FT                   GVFDPYVSAVCPPSSKARSQRIWNRHDICLSCVAPHSMGQFPLDFNLASEICHQPDLAF
FT                   LHGLLISPASFKVSQELIPVFSQSALTGFNDILFPSPWNYIEKVKYQPTKEHPDPEYGH
FT                   KKNSLYWLGSTSEGVSRFGEWKGMPRQRFAHLINNNTNNQVSILLPADPKENSFRYEIM
FT                   DGSAPTSDLHLQTAVHLADPIVRCGDCDEQAAELSTAGWADFQAHWWHRFLFDLDGAGF
FT                   SGRFLPFLHSHSLPLKTGLFRQWFDSRVTSWLHFVPVDIRLHGLWSTLAYFAGVSAPAS
FT                   EENGPNAPKMRMKAHDRQGKWIAEEGRKWANTALRKEDMEIYFFRLLLEWGRLTDDQRD
FT                   VLGFGH"
FT   sig_peptide     join(800677..800720,800787..800823)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5 "
FT   mat_peptide     join(800824..800845,800908..801227,801292..801705,
FT                   801760..801912,801967..802391,802443..804012)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5 "
FT   CDS_pept        join(complement(805672..805797),complement(805387..805619),
FT                   complement(804565..805309))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950867"
FT                   /orf_name="Pc13g03450"
FT                   /product="Pc13g03450 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91414.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI0001830511"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6"
FT                   /transl_table=1
FT                   /translation="MHVFSTILPALALLAQVSSAAYTLRDDYGASDSFFDKFNFFTDTD
FT                   PTNGFVSYVDRSTASRNGLINTGNGVYIGVDHANIATRPGRQSVRLESTATYKHGLVIL
FT                   DLAHMPSSTCGTWPAFWMLGPNWPNNGEIDIIEGVNEQTQNQVALHTSNGCTINNSGFT
FT                   GNLETPNCYVQAPGQSANSGCVIQDGSTQSYGTGFNNVGGGVYATEWTGSAISVWFFPS
FT                   YAVPADISSGNPNPAGWGTPSARFAGGCNIDSKFNDLQIVFDITFCGDWAGSVWGSSSC
FT                   ASRAWSCVDYVQNNPTAFQESYWRVRSLKVYQDAASSKGGAEGEDVGAGDEVGVNWDPS
FT                   TWYGLSARASMKHRREHYRHKRGHGHA"
FT   mat_peptide     join(complement(805672..805737),complement(805387..805619),
FT                   complement(804568..805309))
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6 "
FT   sig_peptide     complement(805738..805797)
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6 "
FT   CDS_pept        join(complement(812085..812378),complement(811601..812033),
FT                   complement(807475..811547))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672456"
FT                   /orf_name="Pc13g03460"
FT                   /product="Pc13g03460 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91415.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001830512"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z7"
FT                   /transl_table=1
FT                   /translation="MAEGSEGWSREDELDLGQEDDPRQPDHGALDQTLPSPQEPAEEEL
FT                   DTIDDAEDQDSEKTARRNYLSYPETPPPRHADWTATGSVDGTGSNPDDSPSLHGSVPSS
FT                   LSSSPLALRGSPRVSPSPARRPFDLRFQSRLSSSPQSVSRAGSPFLAHLHSRQSSITSQ
FT                   LSPTPETEAEPLQGPWEVVRWTKLRKITGQAFSEIGKRNFGRPTCLAVSTSIVIGTSKG
FT                   IILVFDYQQSLKTIIGTGTPAVECGAVTSLALSADHSTVAGGHDSGDIFTWEISRSAKP
FT                   FLHIPPIPANQTETRISDGHLSGSAVIHIGFLGTRRTALVSADTRGMSFSHLATRGMGA
FT                   VGRTVKTTRILGRYPQAAAEVKRRKPSSVLAFSPLPLGNVEQPTDSLGLVAMLTPYLLV
FT                   IVSTTPVAQTQHKAPRPKEVPAHSALTGALAWFPAIRLKGKDTQTSNTKLVYCWSNVLT
FT                   VLEVSEAESDEPADKDKPPSLVFRARSRWRADEAIVAVQWLSRSVLAVFTITQRLLIIE
FT                   DYSMHVTDSVDLANRHIYHTDLFSSQLHSLVEQLDEEDDSMHGVVADAFHMSFRSYKGR
FT                   LFLLGYNEALVGNLSNWADRLLALMEAGDFIGAIRLATSYYTGESEKLTVGLPEEDVLR
FT                   QPIVQEKLLEMISASLKYAFGRNSEASNGRLENQQLEELAEVSIAACVYMSDEEFLWEE
FT                   VFNWYEEQDSAGIFLDALEPRIVDGTLRSLPPIAVKALINHFIGTHSAGRLEEIICLLD
FT                   TTTMDIDQVTTLCKQHNLYDAFIYVWNRCLMDYVGPLEELLHMIPSQPQPLVNGDYAIE
FT                   MRRQNNAMKMFPYLSFILTGRIYPTGDDMDEAEATRAKTDLYQFLFSGRVSGTVPGDTN
FT                   EADSFSQLRAMLKFDASSFMSMLNEAFEDSFLNEPESEDISTSDMLINRQYLVSILLQV
FT                   MTGDLFTPFDIIYLDMFVARNLPKYPQYILLSGTTLHQVLVRVCQYPEQEMAEDCELSA
FT                   EYLLSFYHPPDIQSMIPLFKEARFFRILKSTYRSEKQYPLLVMTYLEDPSDRDAIFTCL
FT                   QDCLRPSSGLGKKQRRDVVDVVKEHAREIAAIDVTHAARTMQDLAPDTHSTFLRVLEDD
FT                   PQKQYQYLLVLVEPQAQTADTRYSPGVENWMIERYVQLLCKYNPSHVADFVDGLRVGDI
FT                   HLEELLPSIEESGAIDAAVILLARQGQVREALDRLVAHLGTLESGLVGILQSVRDSPDS
FT                   ATTAEAIDDLIESLNKYAGVGTWLCQGQTKTAKQSRTGSTNGKRNAPTLDQPLAFDELL
FT                   WLDHIEAVVRIASNVFAFIQGNNAQISLPAQPTDSLAGESGRLTTAFRALVQQVFTALL
FT                   ASTVKSSPTTTERTDISFLRILRAFLTRAATWSPSLLELRAVLASIFSAYSYEKSLLTL
FT                   ANGMLDRDLFVHVDEVSRLRQQGWRPRGHVCEICRSRIWGPSVGEAHWSTWEARRAEVY
FT                   AHRIARRNEDGYNPSDRGKGKAADVGVGHMSHLDAGGAHGHAHVLAHREHGDRGGMSGA
FT                   NADHDHEHCHAEAGAGSSTATTVADSPPEPVVVFACRHLYHRRCVLDAISARARPAETA
FT                   FRRDHLPDWTGAELFCPTCT"
FT   CDS_pept        complement(813346..814896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950868"
FT                   /orf_name="Pc13g03470"
FT                   /product="Pc13g03470 protein"
FT                   /protein_id="CAP91416.1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0001830513"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z8"
FT                   /transl_table=1
FT                   /translation="MHRVPRLTRPIYIRSIQSTVIQRSRLSQRTQPSRKLDSAKMFQPY
FT                   NLTPLDQLSPPGHFTMSLTFNLVGKNRVEALQRMEDAGSCVFSKFPFLSGMVVPSTQRD
FT                   GKSNALQVRPSTAAELEECPIIVTQHHTEPTAITVDGKFNTSLMPFPVVSPPRNPSPVL
FT                   RLKAHVIEDNVHLVLCFDHRVMDGSGIFALFRTFSSFCRDLNATGPFTTTQAQEEIRQH
FT                   IEQVASTATPRDVQWTSLPTTTSEDKVPTDYGRVPIGSSHVFDAQKINILLDACNSTLQ
FT                   SLPEKYRKDLSETSLRPGLLVSALLGICSNRARLRAFPDEPHLSSDMFIVENLRKALNL
FT                   RRGYLGSTIGATQVKCDGYAHPPPESLQNIHVPESLSPVGAEDMWRVCNVAQSLQEVSG
FT                   RLDKEYTEGIIARMSREQDWSSFRPGWGVNFLVSDIKSAKPYGNFGPLGDLELFDLHFD
FT                   TQPGYCWIMPNLPSDTASPYPCWRLRWILERAAMECLSNDPLFQWASTPSTASTHAEV"
FT   CDS_pept        join(816456..817017,817074..817435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950869"
FT                   /orf_name="Pc13g03480"
FT                   /product="Pc13g03480 protein"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91417.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0001830514"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z9"
FT                   /transl_table=1
FT                   /translation="MLAVSGTDTLVQRASQSSAYMSSPSMSTRAATCNGHSEYCTRSYS
FT                   NITFIGSHDSAFVGPLPQQNQNIDIEAQLDMGIRYLQVQTHRSVIDENVIELCHTSCLL
FT                   EDAGPLKEYLETIKNWLDANPNEVVTLLLTNGDSVPITEFGDTFSSSGISNYAYVPSEN
FT                   PLSITDWPTLGDMISSGKRLVVFLDYGADTTKVNFIQDEFAYYFETAYGVTDASFPNCS
FT                   IDRPSGAAATGRMGIVNHFLDVDVLGIKIPARHEADNTNAATGPGSIGAQAALCAGLYG
FT                   YAPNVVLADFVDKGDVITAQKNLNGL"
FT   CDS_pept        complement(817740..819095)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950870"
FT                   /orf_name="Pc13g03490"
FT                   /product="Pc13g03490 protein"
FT                   /protein_id="CAP91418.1"
FT                   /db_xref="UniParc:UPI0001830515"
FT                   /db_xref="UniProtKB/TrEMBL:B6H200"
FT                   /transl_table=1
FT                   /translation="MKVLKSVALASLLSFTGFGQHAFASSSLKKPILHDFDDDGVDGGL
FT                   YRPSVAGPKSRIAVYIMHAEQDYTSFVACEALQERGFTVFCANNDASKSGYMSDLNFED
FT                   MMTNVNQGMTYLRNLTDIDKVVILGHSGGGAMMAAYQDIAENGASACQGSEKIYPCSDE
FT                   MDDLEPADGLILLDANYGLSTMAFLSLSPAIIDESSPSKINETLNVFNPANGFNNTRSN
FT                   YTAEFKKAFQSGAVARNNRIIKHAQERLAAIEAGNGTYSDDEPFTVPASLYIGFNNLFF
FT                   AQDTRYLAHTTHAWPLLHKNGTTTQVVRSVRVPANFKSFADQWEGGALKTTVKRYLSTF
FT                   AIRVGDDYNLRADGIDGIDYASSNLAPVASIRGVSVPLLTMGMTGHYEYLNAEKLHLAA
FT                   GSNDTTIAFVEGAQHTIDTCTACESFPGEFGNTVVTCFNHVENWLAKKGRFI"
FT   mat_peptide     complement(817743..819023)
FT                   /db_xref="UniProtKB/TrEMBL:B6H200 "
FT   sig_peptide     complement(819024..819095)
FT                   /db_xref="UniProtKB/TrEMBL:B6H200 "
FT   CDS_pept        join(complement(821218..821412),complement(820806..821151),
FT                   complement(820605..820725),complement(820323..820524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950871"
FT                   /orf_name="Pc13g03500"
FT                   /product="Pc13g03500 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91419.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830516"
FT                   /db_xref="UniProtKB/TrEMBL:B6H201"
FT                   /transl_table=1
FT                   /translation="MSLNWTNLIRFISEEDGQIHLGEVDTRKYPDIGLTVLNGERVAVN
FT                   LVKGSIFDGVVTETIMHVGRLLAPIGIEEVPIIRCMGLNYRDHATEANMPIPDVPVLFI
FT                   KPRTALNGPYPAKINVPKIAQDGSSDYEAELSIVLSKSGRDIPESEAMDYVLGYTCSND
FT                   VSARTQQFKNSQWCFSKGLDGSCPIGPVLVSPSVVGNPHNLRIKAIHNGTVVQDSNTRE
FT                   MIFDIAKTIAFLSQGTTLERGTIIMTGTGPGIGVMRNPKVVLNDGDDMRVEIENIGTLI
FT                   NKVHYE"
FT   CDS_pept        join(complement(822885..823305),complement(822604..822711),
FT                   complement(822298..822532),complement(822129..822238),
FT                   complement(822041..822072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825156"
FT                   /orf_name="Pc13g03510"
FT                   /product="Pc13g03510 protein"
FT                   /protein_id="CAP91420.1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI0001830517"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y7"
FT                   /transl_table=1
FT                   /translation="MTVNITPRINLVRIAHVFYTYKDLNKAHEFLLDFGFQEVKRAGKD
FT                   IYYRGTSSQPFVYCARHGEEDVFGGAAFVVESEADLVASQELPGATEIYGLSDAPGGGR
FT                   CVTFHDPIDDFPFHLVYGQTHWADEKALPQLNFNFVSPAPVHKIGHFGTCVTDFAKAFD
FT                   FYTTRFNFKPSDVYSTGKDITTFLHLDRGSELVDHHCFFFFEGPKPHVHHSSFETHDFD
FT                   TQVLGHDWLRSKGYQNCWGVGRHIMGSQIFDYWFDPSHFIIEHYVDGDLVNDEYPINRS
FT                   LASPGNLHVWGPDLPPTFLQ"
FT   CDS_pept        join(complement(826118..826181),complement(825568..825955),
FT                   complement(825134..825499),complement(823622..825086))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978322"
FT                   /orf_name="Pc13g03520"
FT                   /product="Pc13g03520 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830518"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y8"
FT                   /transl_table=1
FT                   /translation="MVCQGFDKGISICSKAHEVTSGSLQKRRKCRRSEDTAQSRHLHLQ
FT                   SNSYNPNLCSDNNDLDVLNDESETEGLVPTDYAETVHRTKTDEGGKTQTSHLNMHDLSY
FT                   ILHPSHESTIPNPDRNRSACSNDGEKGGVRRQACAELGVSQSAMNQMIRAFFENMVAIN
FT                   IFHEPSFAEKLSNISSLCQLSALLAAIAAYSSRFIGSGTNISSLGEHRTAGKSQQQPEY
FT                   FVGLAFNYVNKALVACDDETPSLCILQALIIATHCQLTRGVRGKAWRSLGLGVAKPDNI
FT                   HQWQADEEKRRAFWAVWEMDVFASTIRQAPTAIDWGHMEILLPVDNANWFLGRPSSSCF
FT                   MDADPNQSWKALQDSGNQSPKAWFLVINSFMKIAHSISDPRRLSAMDNAGHYQPGHPTP
FT                   GLDEERCWKLEKLGNAVRCFNMALPSHLRYHDQYLAFGAPVQGRLESQRQQHCSLYNIF
FT                   VMTQLVWLMIHRHDAFRPQTRQAETNHFYPPGDGVVAGGVISSSHETECTAQRQYYDAA
FT                   DRILRIVSQSCEDHIQHISPFLSSTFWLVSAVQLVRKHFTREPANRSLIESRFDVVYMT
FT                   YRRCVEFWGTQTAMQRNLESLEEQLEARKRKMNSHESQASSAHQTSHIERHTKRKRTHQ
FT                   TVSRTTEQDYLPHLPTGRSVRNNLPEYIPETPIPLEASALPVGDSQSYVRQHPAAVDSM
FT                   AMVDMMLPPQSDRGHSSGTCMMPTSSDYFDPTVLNLGDVHDDQILDLRDFDLSGGIQDL
FT                   LAEWITY"
FT   CDS_pept        join(complement(827736..827742),complement(827346..827574),
FT                   complement(827132..827267))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825157"
FT                   /orf_name="Pc13g03530"
FT                   /product="Putative uncharacterized protein Pc13g03530 "
FT                   /protein_id="CAP91422.1"
FT                   /db_xref="UniParc:UPI00018305DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y9"
FT                   /transl_table=1
FT                   /translation="MIAIDKFFKYVVFPDLKTVMNQLLDFILSDRRLQIDFDHATYKSI
FT                   VKALRGQNNFMDLAFEAILPEIKGFQGKLITTQDLHKDSPNTIVEFGISKEPEYVASSA
FT                   IRDSEISDQDDLMDLPRPR"
FT   CDS_pept        join(complement(830381..830504),complement(830239..830337),
FT                   complement(830046..830194),complement(829339..829952),
FT                   complement(828420..829278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950872"
FT                   /orf_name="Pc13g03540"
FT                   /product="Pc13g03540 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91423.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00018305DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z0"
FT                   /transl_table=1
FT                   /translation="MSSTAQATNSDKVEDHGLDTEFLIVGAGPAGAALACFLGSHARRA
FT                   QGHYDQQRGRDSKYPSRTHYQYGSTWYVTECLRDIGLYEELQKLGSTGEDHMQHTRWCH
FT                   SMAGEEYARIHSWGNDPRRKGDYELASPCEPFDLPQTVMEPVLVRHAALKGFKCRFDTT
FT                   LISFNEEKTGLITATIRDEISKNEYYIRTKYLLGADGARSQVVKQLNLPLAVLPRQGMA
FT                   INVLVRTDLSHLVKNRTGNLHWVMQPDREHPNFGWMGIVRMVKPWSEWMFILFPDRSYN
FT                   RSQGQPSTEEYQKRVQEFIGDDTPAEILDISTWYINEIVAEKYSEGNIFCLGDAVHRHP
FT                   PLNGLGSNTCIQDAFNLAWKLAYVHKGLASPSLLSTYSSERQPVGHSIITRANQAYRDH
FT                   FHVWEALGMLPTDLSERKQILEELRSATPQGSNRRRALHAAIKHTSHEFHGLGIKMNQH
FT                   YQGQGIYMADEPHPYDQVGRAGEDKVLYHGPSTYPGSRLPHVWLNKATPGEAISMIDIA
FT                   GHGVFTVFTGIGGGVWKEAAVAVAEKLSVPIRACSIGFRQDWEDVYFEWGSVRGVEESG
FT                   AVLVRPDRFVAWRASEALQDCEACEGKLLTVMRSILGF"
FT   CDS_pept        complement(831174..832496)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950873"
FT                   /orf_name="Pc13g03550"
FT                   /product="Putative uncharacterized protein Pc13g03550 "
FT                   /protein_id="CAP91424.1"
FT                   /db_xref="UniParc:UPI00018305DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U6"
FT                   /transl_table=1
FT                   /translation="MPPKSSTRKGGKKGMSHTLSPDPSSSPIRKKQKGTPSAIRDRANS
FT                   SSRSGIPKLEPSSGAHPPSEYWNQLTDFQRDFLDGAMQETVSNLYDLGAEIKAETSSPA
FT                   PSSIINDENESQYSLGTPVPGPIPAPFPYTVDDLTLCHAPTADPTGYPIFVSRNGRWDW
FT                   YYLSSNTKTTETPANGTSNGNTTNTKSEFANDLCLSPNQFPCTKDDTTLCPCPNPGPNS
FT                   AYSPTFSSQNGRWEWIFLPSNTDTESSPPKVKMEDIPEANPRVQRPSNPLSTTFSATDL
FT                   DHFVFHGLQDSDDDENIIERARTENIELAKTVKHVKFFMNNSHDKHFVPFQVPALIGYE
FT                   NWEPWLAGMYLLFRQHSVWPVVTAELEPLPPGHNLHLWYNRMLDCAVALIYANVSDVVR
FT                   NTHCLMSTLHDDDPDELMAHLYAHYAEPDLTHPPHEESELD"
FT   CDS_pept        join(complement(835699..835715),complement(835402..835453),
FT                   complement(835111..835349),complement(834034..835057),
FT                   complement(833765..833987),complement(833481..833713),
FT                   complement(833218..833429),complement(833003..833144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950874"
FT                   /orf_name="Pc13g03560"
FT                   /product="Pc13g03560 protein"
FT                   /protein_id="CAP91425.1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI00018305DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U7"
FT                   /transl_table=1
FT                   /translation="MPTSSLQLIAAPRRSDAIPNPSGEVALFSTSEYSFETHATSSWWS
FT                   LLDLETGKVTQLTNDSNVSELTWLGSTDSGLLYINGTNAEIPGGTEIWVSDTSDFANSA
FT                   YKAASLPAPLSGLKTAITKSGDINFLVYGESWPNGTAYNKELVAAPLSSARIHDSIYVR
FT                   HWDTWLTTRFNAIFSGTLKKKRAGPGATSAYTSSGSLKNLVAGVKNLESPYPPFGDASD
FT                   YDISSNGKLVAFKSKAPELPRANHTASYIYVVPHDGSKKAVAINGPDSPGTPKDIKGDS
FT                   SSPVFSPDGRRIAYLQMEDISYESDRRTVYVYTIDSKDTIRTLAKDWDRSPGAIKWTAD
FT                   GKSLVLNTEDSARSRLFLLPADAGDDFKPKNFTDGGSVAAYYGLPNGEYLVSSSAIHTS
FT                   RTVYTAKPDEGVTGVIFSANEVDPALKNLDPSGVDEFYYKGNWTDIHSWIIYPSDFDKS
FT                   KSYPLLFYIHGGPQGSWGDSWSTRWNYKVFADQGYVVIAPNPTGSTGFGDKLTDEIANN
FT                   WGSYPYDDLVKCWEHVRDNFDFIDTSRGVAAGASYGGFMINWIQGNPLGREFKALASHD
FT                   GTFVADAKVSTEELWFMQHEFNGTFWDNRENYRRFDPSAPEHIKQFATPQLIIHSDLDY
FT                   RLPISEGLALFNILQERGVPSRLLSFPDENHWVINKENSLVWHQQVLGWLNKYSGIDTP
FT                   GSVNLDDTTIPVVDYNPQL"
FT   CDS_pept        join(complement(837165..839109),complement(836835..837065),
FT                   complement(836240..836785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672457"
FT                   /orf_name="Pc13g03570"
FT                   /product="Pc13g03570 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91426.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018305E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U5"
FT                   /transl_table=1
FT                   /translation="MPPIRSQSSTNSTEQEGRILLAIQAFKNGDITSVALAARTYKVPR
FT                   TTLRHRLSGVQHRAISRANSHKLTQIEEESLEKWILSIDARGSAPRPSTIREMANLLLE
FT                   KRGTTPVLSVSDKWVYNFINRHPLLSSRFSRRYNYERAKCEDPKIITEWFNLIQKTILX
FT                   FGIDPDNIYNFNKTGFAIGLTATAKVITRSEYYGRRTLLXPRNREXVTIIECTNATSXA
FT                   LPPCMIFKGKVFIESSTASRRTSDLRLVLIDRPLMKLDFALKKLFIPTTSLRTKGGYRL
FT                   LILNGHRSHLTPRFDEICEENKIILICMPPHSSYLLXPLDIGCFTVLKRSYGRMVKIKM
FT                   RNGINHIDKLDFLEVYPLARIEAFKSETIKNSFRVAGLVPFTPERVISKLNIRLRTPTP
FT                   PPSRGSDWDPKTPSNYIQLEKQASSIKVLLRIRSKSPLSPLNSAINQVLKAYQITMQSA
FT                   ALLEKEVSDLRAENEKKKQKRTRSIRTIVHEGDLLVQEVRELRSEPFKAQVARINNYRE
FT                   RVSEGLRPPPQAGRACGICRKPGHRRETCPDR"
FT   CDS_pept        join(839678..839710,839764..843140,843230..843257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672458"
FT                   /orf_name="Pc13g03580"
FT                   /product="Pc13g03580 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91427.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018305E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U8"
FT                   /transl_table=1
FT                   /translation="MDNLRQESFKQLRAPCVELSSVGLRFRGNQASAADVARVLDPVHN
FT                   CLKELARNNTLDEKLAEYAFFPLSHIFNETQRLPARCLESAIHCLRILVADGWRQRLSP
FT                   AMGKQLIILLTLIVGGSPNKAEEKQLPKPKVSEELCIAGFDCLSAIFTVLKGAVPERTI
FT                   YHEIGTATVVDQTVYILLEGIVDDRLDELCLAAAKALQALYARVTDRVVLASIMPRTVS
FT                   ALAKILRPSTQTRRSYKLLETSLQILTELLRAVLNDRVASEVSPPELGSDKVALDEAWL
FT                   KATTTQIKLALANVVQVRRHQRPEVQSAIQDLCLMVIEECQTTLSESLPIMVETVVVLA
FT                   DKEDEGVNEAYRNLTHLATTYPAVLDSLKESLHTWLTSFPRIMQGNDETAKQWGLRQIS
FT                   TVFQILSQVQSGSDLLTSGLASGLCDSVGAVVKQNTNSLQPLASMDAGFNWEVLSTDAR
FT                   SKVFPPIILEHQSQQQTLKDLRSMITRLNLSESGNEITRSIVNRMHTTSGGSAIAPFWL
FT                   AMTFLRDTTTETASFDDFISLDHIEGSISLTGRGGMIEELYYISINILNELSVDGTGDW
FT                   RTSALALESVALQAQQLGEAFRPELMDALYPTLQLLASQNPNLQRHAMTCLNILTSACN
FT                   YPDTSTMIIENVDYLVNSVALKLNTFDVSPYPPQVLFMMVKLCGARLIPYLDDLVDSVF
FT                   GILDLYHGYPKLVEMMFKTLAAVVEEGARKPSLLTIDEGKGNGSHDTRKSQYQNLSISS
FT                   IAADIANRKAKRHAEDALADADGKIPHPKKPWSETYDKPPPEPSIEELLDQAESEEPPL
FT                   PPPKEPEDAEKPLTKTHALLLHIVKSIPSHLTSPSPYLRRSLLSILIDVLPALSQNETS
FT                   FLPLINELWPTVASRVIFPSSQANETSKSLIATPSTESTRKPETPDHQEEIFVTVTACE
FT                   AMEAMCKGAGDFMATRVETEFPRWDRLYRRVWEKVRADAEAANERRARSQATTVPGAVA
FT                   KPGDMASTLHLALSSSLSLSPSTPGSKFFTPHHRLWRALISLFTTVLSHVRLPLEVGDR
FT                   ICEMLCGWIALFVGPEYYFISSRTSMSVDDSASGESMVSVEDAIRAMEAWNVDLTWFAF
FT                   MRHRLGPDVVTTGATDLPFNGDGEPVRLAEYLSADDMD"
FT   CDS_pept        complement(843458..844699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950875"
FT                   /orf_name="Pc13g03590"
FT                   /product="Pc13g03590 protein"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAP91428.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI00018305E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X3"
FT                   /transl_table=1
FT                   /translation="MATVNIRRDITDPFYRYKMEKLQAKVEGKGNGIKTVVVNLNSVAQ
FT                   SLSRPPAYLIKYFGFELGAQANAKPSDDRWIINGSHDAPKLQDYLDGFISKFVLCKKCK
FT                   NPETDVIIKDERITLDCKACGQRSDVDPRLKLSTFIVRNQPKGGKKEKKKSRREREKEK
FT                   AANGEEASPGDSQNSENGEDEDLAIEANSDDEVTRQAQAIEAEKEIKDDEWAVDVSEEA
FT                   VKARAKDLPSDLKRALVIEDGDDEGADGPSSYEQLGSWIVDTAAEKGGVTNVTDVEIYM
FT                   KAKEFGIENKHKTVAVLAQSIFDEKIAKQIEGRAGLLKKLITSDRHEKAFLGGTERFVG
FT                   QDHPELVAQVPAILLGYYQNDLVSEETLKAWGAKTSKKYVDISTSKKIHKAARPFIEWL
FT                   ENAESDEESEEESE"
FT   CDS_pept        join(845721..845820,845875..846024,846101..846236,
FT                   846294..846701,846753..847129,847183..847283,8
FT                   47339..847593)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950876"
FT                   /orf_name="Pc13g03600"
FT                   /product="Pc13g03600 protein"
FT                   /function="ATP binding"
FT                   /function="hydroxyethylthiazole kinase activity "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAP91429.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004417"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI00018305E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X4"
FT                   /transl_table=1
FT                   /translation="MTVDLSLYLVTDSTPAILKGRDLCTVVESALQGGVTVVQYRDKTN
FT                   DTGVQVETARKLHRVTKKYNVPLLINDRVDVALAIGAEGFTEAKKLLPENAIIGISTSS
FT                   VEEAKKATADGADYIGIGTMFATPTKTNTKSVIGTAGTQVILDAIKDSPIGTVSIGGIN
FT                   HSNVQRVLYQSQSPKKALDGVAIVSAIVGADDPKASAEHFVELIRNPPRFAQIANPPRA
FT                   NEAEALLNEVPQIIRKMVEVHPLVHNMINFVVSNFVANVALSIGASPIMSPYGDEATDL
FT                   CKFDGALLINMGTLTSESVSNYVKAIKAYNDRGNPVVYDPVGAAATHIRRNAVAQLMAG
FT                   GYFDLIKGNEGEIRQVWGSSAVQQRGVDSGPSTLDGNQKATLARDLARRERNVVLLTGA
FT                   TDYLSDGERVIAVENGHPYLGQVTGTGCAIGTISGCFLAAHRSDRLLAVLSGILMYEIA
FT                   AENAAAKEYVRGPGSFVPAFVDELYAIRTAAANGDDSWFAGRAKVHEVKL"
FT   CDS_pept        join(847843..848062,848101..848633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950877"
FT                   /orf_name="Pc13g03610"
FT                   /product="Pc13g03610 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91430.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI00018305E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X9"
FT                   /transl_table=1
FT                   /translation="MAVTTRASRTRKKPPNFTMQVTNIKPGNPALLYAKPPVSIKRYPL
FT                   KAKADSPSNTVSATSKKNSAMESTNSPNSNQPNSVSTTEKMLRAASTLQIPVFITTQNR
FT                   AKLGNTVTELQQHLNGPHIRADVDKTLFSMITADIEKLIPAPDSTPLDVIIVGIETHIC
FT                   VTQTTLDLLERGHRVYILVDGVSSINPEERGIALARLRDAGAVVTSSESVLFEILGDAA
FT                   HESFRTVSGLVKETKETTKGALGVFSKI"
FT   CDS_pept        complement(848773..849897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950878"
FT                   /orf_name="Pc13g03620"
FT                   /product="Putative uncharacterized protein Pc13g03620 "
FT                   /protein_id="CAP91431.1"
FT                   /db_xref="UniParc:UPI00018305E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y0"
FT                   /transl_table=1
FT                   /translation="MARLLDLPAELILAIIDYLQVDTKEASLLFDRLGYDQVYSPEPPL
FT                   SVSRLHSFLLANCRLNSLLQPLLYRDIFVRRNVQLKQLSRSLQNNPSLKEHIISATLPW
FT                   HSSMHGTLNGISHFFWFNNLRTLTIYGFCDWDSLKFDDSLIGTSSVECLRLIACGAHEQ
FT                   PLTTLLSWPVALKTLYYGIDKREWRLNYLFQLKRTLWTRAAFMRALQRQKATLVELTLA
FT                   RSWDDEDYLRNGPHLDLSEFTSLKTLRICHTFLGVNSHTPYEAWEGLPHSLEVLEVSYD
FT                   DTDRALFVWANYKYDRFVLHLINHKRTYRTHLHTVIIHSTEKVHDLETGEKRPIGLLTW
FT                   PSLTREAESAGIELKMGLGYEDAPTTRKVTFPSP"
FT   CDS_pept        join(complement(852216..852414),complement(850750..852158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672459"
FT                   /orf_name="Pc13g03630"
FT                   /product="Pc13g03630 protein"
FT                   /protein_id="CAP91432.1"
FT                   /db_xref="UniParc:UPI00018305E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X2"
FT                   /transl_table=1
FT                   /translation="MDAQYPFASRDDIWRVFDELKELHIAQYEQGERLAQLERRRDDDA
FT                   RLRSPWCPVSPFPQSAGAIAPDPTFPSPPDAFKGFDQGHHSAMASSAVGFDAEDEPRRG
FT                   ASRANSVRFDESAIHGNGQASRSSNDLPLRTGSGLSTHPLLERTFSHQSDGRLSSSGHS
FT                   HHSARTNSLRLNTTRLLGTTPIESPLIPPPGLFLLGPVPSIIRCWLTDTFTNGSLLYAA
FT                   VCSGSYVSTLGLSMVREFGMENMIVRESDVQYIKLPLYLPEALIHPSSSRPGTPTHQVP
FT                   TVTIRFVVREIDVGDGSIQIIIGSDVMRAHNADILFSQDKLIMVDDDHNRVSVPLVRPE
FT                   KDSVFKSLCTYPGTSDSGVILGPPTNGNPSVGIIGRPANVPQKPASAPPSARLPGSENI
FT                   DPHKSHLQNSQAHAHISAETRPASAHPPTPEPTKTEDMSCWSSWRRDPKRSTTTQKPAD
FT                   KREMKVFRTGKSASHANSTTSVSAPGSATAEQADKSSVPFTSVHHPTTPSDRHGTLNPV
FT                   GGASAFGWLNSPHHNASS"
FT   CDS_pept        join(854373..854487,854564..854703,854820..855062)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978323"
FT                   /orf_name="Pc13g03640"
FT                   /product="Pc13g03640 protein"
FT                   /protein_id="CAP91433.1"
FT                   /db_xref="UniParc:UPI00018305E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X5"
FT                   /transl_table=1
FT                   /translation="MDPTTPSDWPPSDLSSSSEDNKKNAPTMDSRPTAKELLDRVDYDI
FT                   SQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWL
FT                   FGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSEEPDKPEKSEDTEKHRAVP
FT                   EA"
FT   CDS_pept        855551..856378
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672460"
FT                   /orf_name="Pc13g03650"
FT                   /product="Pc13g03650 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="dihydrofolate reductase activity"
FT                   /biological_process="glycine biosynthetic process "
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91434.1"
FT                   /db_xref="GO:0004146"
FT                   /db_xref="GO:0006545"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="UniParc:UPI00018305E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6"
FT                   /transl_table=1
FT                   /translation="MPPHNPHHLPSLTLIVATTPIRTASTTTKEEITRLGIGLNGTLPW
FT                   PRIKTDMSFFARVTSRPPTPGTTNAIIMGRKTYDSVPGSLRPLAKRINVVITRDTSGSV
FT                   RESVTTELGNMRRKIAAKAAQTQATNSEKGTFDPPKEAAPADPMTDAIVTPSLGAALET
FT                   LDSVYAAQGKLGKIFVIGGAEIYNATLNMGAEELRGRPVRVVMTNVVRKGAVGASASFE
FT                   CDTFFPLDGLHEKNGWRAVSPREVSEWVGEEVDGEWKTDGDVEVQMVGYEKST"
FT   sig_peptide     855551..855619
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6 "
FT   mat_peptide     855620..856375
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6 "
FT   CDS_pept        join(complement(858657..859495),complement(857306..858506),
FT                   complement(856866..857252),complement(856651..856809))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129522"
FT                   /orf_name="Pc13g03660"
FT                   /product="Pc13g03660 protein"
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91435.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI00018306B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X7"
FT                   /transl_table=1
FT                   /translation="MPRSLPKTSFASREQEDTENTRSAQTAPPSPSAYRRSQSYLSETH
FT                   TEYQSLDPPLEITEATSLLGPQAARRRGPRRSYTSTSGVSGTGPDSLRHVLAAGSLRRT
FT                   RNHSRANSMGRRVSRRGSIDGDGEPASLPPSTKDNLTASAFLDERTWYDQFTSTDWVHD
FT                   SIADGARLRLLRQRKDVRGRLLAAFDGAQGWILVALIGCITASIAYFVDVTEGSVFDLK
FT                   EGFCTTQFFRNKRTCCEGLATCDAWRPWSRIFSPSGTERQWVDFVIFVIWVVTLALISP
FT                   PHGTLPNYPPRPAMIYYSAAGSGVAEVKVINSGFVLHGYMGLKTLVIKTIGLIFSVSSG
FT                   LSLGKEGPYVHIATCVGNISCRLFDKYNQNDGKRREVLSASAASGVAVAFGAPIGGVLF
FT                   SLEEVSYYFPPKTLFRTFFCCIAATLSLKFLNPYGTGKIVLFEVRYLSDWQIFEIFIFI
FT                   LLGIMGGAAGALFIKASSLWARSFRRIPAIKRWPMFEVFLVALFTGLVSFWNRYTSLPV
FT                   TELLFELASPCESDVESTGLCPRTDGILEIVQDLLVAFVIKSFLTIITFGIKVPAGIYV
FT                   PSMVVGGLMGRIVGHLIQYWALRHPTFFLFDSCPAVAGIESCVTPGVYALIAAGATMCG
FT                   VTRLSVTLPVILFELTGSLNHVLPFSLSVLCAKWTADAIEPRSIYDLLTDMNSYPFLDS
FT                   KLQPTTDAVLGDIVRPVRKNRIIDISASPFLPATELRLKLEHLLMAGELDSGLPILCDG
FT                   VLAGLIPAPDLEYALDTLGDEEENTICLMTMDASTVLYDSDNEDAEQVDFSRYIDPAPI
FT                   ALDVHSPIDLVYQCFAKLGLRYLCVTQNGKYAGLVHKKAFVKFMKENSD"
FT   CDS_pept        join(862510..862642,862707..862746,862796..862874,
FT                   862950..863340,863394..863527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825158"
FT                   /orf_name="Pc13g03670"
FT                   /product="Pc13g03670 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91436.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018306B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X8"
FT                   /transl_table=1
FT                   /translation="MAAIEKGNEDAFKPYDQFLLFGDSITQMGCNQELGFAFHAALQES
FT                   YSRKLDVINRGLAGYTTAHAVKVFDKFFPSPQTANVRFMTIFFGANDACVPTHDQHVPL
FT                   DQYKKNLKTIIQHPATRAQNPRLMLITPPPVNEYQIEEFDASKNTPFPSRTASFTKSYA
FT                   LAACEVGASLNVPVVDLWSAFMKITGWKEGDPLIGARDVPRNDKLASLLTDGLHLTPAG
FT                   NRIVYDEIMKVVQANWPDQTPETLPMVFPAWGDAPK"
FT   CDS_pept        join(complement(864926..864935),complement(864845..864867),
FT                   complement(864714..864790),complement(864365..864661),
FT                   complement(864234..864312),complement(864010..864180),
FT                   complement(863919..863954),complement(863785..863820))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672461"
FT                   /orf_name="Pc13g03680"
FT                   /product="Pc13g03680 protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAP91437.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI00018306B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y1"
FT                   /transl_table=1
FT                   /translation="MTTAHRPTFDPAQGKEALRGPAYHQRLLPAHTHLKVRQPGQGGEA
FT                   DAHLSPRDLRAELLQAEAAHFAKKNGVPVEQPAIAESSVPKRQLEAAPEDGIDGDIKEE
FT                   DPEAKRRRILEETRDIDADSDGSEEDSSDEDSDDDEAAELMRELEKIKKERLEQKEKEE
FT                   RERALEEEEQREVDIARGNPLLNSQDFNMKRRWDDDVVFKNQARGTENRDGKEFVNDLL
FT                   RSDFHKRFMISVLEGFQLSE"
FT   CDS_pept        join(865194..865357,865417..865536,865596..866205)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950879"
FT                   /orf_name="Pc13g03690"
FT                   /product="Pc13g03690 protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP91438.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00018306B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H218"
FT                   /transl_table=1
FT                   /translation="MSKEAQLSIAERDFILEALRENVRLDGRQPDDYRPLNISFGEEYG
FT                   HVNLQLGKTNIIVRISAEVTKPREDRPFDGLFNINLELTAMGSPAWESGRTNDIEAYAT
FT                   NTLDRIIRHSNALDTESLCILKGVSCWSIRADVHVIDYDGNITDAACIAIMAGLQHFRR
FT                   PDAVVRDGRVIVYGVEQRVPVALNITHKPLSVTFHTFNDSKHVIVDATLKEEQAAEGDL
FT                   VIGINSAGDVCYLSKYAGAPADAMVIVKKTNVAWEKVKEINAAVEKVLQADLAKRAKIG
FT                   MADESRAENDRLVQIE"
FT   CDS_pept        join(866999..869928,869983..870286,870337..871185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129523"
FT                   /orf_name="Pc13g03700"
FT                   /product="Pc13g03700 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91439.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018306B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H219"
FT                   /transl_table=1
FT                   /translation="MASGRPPGSHPAAGRDDDLLLDSGPMYSTGQGPPVNDEHLLERYN
FT                   IDDSEQPYAQTQPRPSVSYDNFVGSSVQQGATRHNVASGPAHPPVNPGLHSNDPYSSGT
FT                   RDRTYSQTSGLDNYRRYSLDDFDDGHSGYYDLDADEDRIASSHHVRKANERNSVLGLGG
FT                   GFMGKAKYMFGMGSSQYSEMDLPLTESGARRATVGSDASPAPPPKQRKKFRASDLNIFS
FT                   RKVDPSTLGPRMIQLNNPPANATHKFVSNFVSTAKYNIFTFIPKFLFEQFSKYANLFFL
FT                   FTAVLQQIPNVSPTNRYTTIVPLAIVLAVSAIKELVEDYKRRMSDRGLNYSKTQVLKGS
FT                   SFHEAKWVDVVVGDIVRVESEQPFPADLVLLASSEPEGLCYIETANLDGETNLKVKQAI
FT                   PETAHLVSPSDLSRLSGRVRSEQPNSSLYTYEATLTMNAGGGEKELPLAPDQLLLRGAT
FT                   LRNTPWIHGIVVFSGHETKLMRNATATPIKRTAVERTVNIQILMLVSILIVLSVISSVG
FT                   DLAIRKTRSSTLAYLGYGGSVKLVKQFFMDIFTYWVLYSNLVPISLFVTIEIVKYFQAF
FT                   LINSDLDIYYDKTDTPAICRTSSLVEELGQIEYIFSDKTGTLTCNMMEFKQVSIAGVQY
FT                   GDDVPEDRRATVEDGAEIGIHDFKTLKKNLQSHPSQNAIREFLTLLATCHTVIPERNSE
FT                   DPNVIKYQAASPDEGALVDGAASLGFRFTNRRPRSVIFEVGGQELEYELLAVCEFNSTR
FT                   KRMSTIFRCPDGKVRVYCKGADTVILERLHPDNPTVEATLQHLEEYASDGLRTLCLAMR
FT                   EVPENEFQQWHQIYDKASTTVDGNRADELDKAAELIEKDFYLLGATAIEDRLQDGVPDT
FT                   IHTLQTAGIKIWVLTGDRQETAINIGMSCKLISEDMTLLIINEETSEATRDSLQKKMDA
FT                   VQSQISAGDSEPLALVIDGRSLTFALEKDMEKLFLDLAVICKAVVCCRVSPLQKALVVK
FT                   LVKRHKKALLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADVAIGQFRFLRKLLL
FT                   VHGAWSYSRISRVILYSYYKNITLYMTQFWYSFQNAFSGEVIYESWTLSFYNVLFTVLP
FT                   PFAMGIFDQFISARLLDRYPQLYQLGQRGIFFKKHSFWAWILNGFFHSLILYIVSELLY
FT                   YWDLPMENGHVAGHWVWGESLYTAVLGTVLGKAALITNVWTKYTFIAIPGSMALWLIFL
FT                   PAYGYAAPALGFSREYYGTIPVLFKSPIFYLMAIVLPCICLLRDYAWKYAKRMYYPQQY
FT                   HHVQEIQKYNVQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADDGGQMRVLNAYDT
FT                   TRSRGRYGEMASSRPMA"
FT   CDS_pept        complement(871784..873772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950880"
FT                   /orf_name="Pc13g03710"
FT                   /product="Pc13g03710 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91440.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="UniParc:UPI00018306B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H216"
FT                   /transl_table=1
FT                   /translation="MIAWPDSSLKDKTEHVSIFSSQPPIFILPMHLSLEELDEVEGRVI
FT                   DYGGRLTYDIAEAGLVLGKVGRAKRAALELRTRGVWTEELIPSSASKSTGGAEPPVKRR
FT                   RTAQYDGTKDVPVEIIDLSTGSEGEDGTTNQHGSPKHPIPEGEAKAIKDSITVLKLEWL
FT                   DASITSGKCVSQDSFVVYRGRKIPSPPPTTGAENKQNLLQKSNQIIERAKQDAGLPTPR
FT                   TPPPDHIHARRSREPPDGYSQRHRPTLYRQTTSEHEKEVENAPPQPDWVRDHVVYACLR
FT                   SAPLHPPNEDFISQLVKIRRIRELTLDEIGVRAYSTSIAALAAYPHPIQRPSEILALPG
FT                   CNAKIADLFFQFQQHGGCEHTDDDGNVAAAEALETDPMLRVLNSFYQIWGVGAKTARDF
FT                   YQRGWRDLDDIVEHGWDTLSRVQQIGVKFYEEFLEGVPRAESEGIASVIRDHAGRVRGE
FT                   EGNGIECVIVGGYRRGKELSGDVDIVVSHRDDAVTRNLVVDVVASLEAERYITHTLALH
FT                   LTSSLREQQTLPFDGDDRRKFDTLDKALVVWQDPDFDDTTPGHNEHQGKKKNPNIHRRV
FT                   DIIISPWRTVGCAVLGWSGDMTFERDLRRYAKKARSLKFDSSGVRDRVSGRQVDLERDG
FT                   ETWEEREKLVMEGLGIGWRPPEERCSR"
FT   CDS_pept        join(874634..874792,874874..874910,874995..875048,
FT                   875103..875219,875371..875411,875513..875561,
FT                   875633..875698,875827..875978,875996..876064,
FT                   876095..876236,876298..876347,876367..876469,
FT                   876548..876687,876776..876809,876850..876907,
FT                   876978..877559,877617..877716,877807..877924,
FT                   878484..878696,878780..878842,878922..878968,
FT                   879058..879132,879180..879557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978324"
FT                   /orf_name="Pc13g03720"
FT                   /product="Putative uncharacterized protein Pc13g03720 "
FT                   /protein_id="CAP91441.1"
FT                   /db_xref="UniParc:UPI00018306BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H217"
FT                   /transl_table=1
FT                   /translation="MSLRAGRGYNASMVASKRCEESTGKTHLTKKVDKATCVQVGPRGF
FT                   TRGLIGNMLANLLACPEADYDQPTDCPEGKACHGQARCDQPAVFPEAKRTDTVRLEVVD
FT                   RSGFVDQRADCRVAEDGHDWKWLNGVPRLIEVAADRPKAEARRSQTRSGVLVAQPADCP
FT                   EPKARHAQTGSAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPKAEARHGQTGGW
FT                   LIGPADCPEAEARHGQTGSGGSWSIESADCPEAKARHGQTGSGGSWSIEVVDWGVLTDQ
FT                   SADCPEAKARHGQTAEARHGQTGSGGSWLIVVVDWGLVDWGLVDWGVLTDQPTDCPEAE
FT                   ARHGQAGPPRSDWGLVDWGWLTDQPADCPEAEAEARHGQTGSGGSWLIGVGIELTHRPN
FT                   AEARHVLIDQSADCPEAEARHGQTGLPIVLKPRPATVRLIVGDLTAWLGSLIAQPADCP
FT                   EAEARHGQTGSGGSWLVEVGIEVVDLGVLTHQPADCPEAEARHGQTGSGGSWLVEVGIE
FT                   VVDLGVLTHQPADCPEAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPEAEARHG
FT                   QTGSGGSWLIGVGIEVVDWGVLTDQSADCPEAEARHGQTGSGRSPPRSDWEWFIGGWLI
FT                   EMDRVVDRRVHRGSAMIPKKQRRDSFPASATGLVRSSTHCEPKEPLGLITLEFSPATGL
FT                   VRSSTHCEPKEPLGLITLEFSPGMKIERNSGSTRHSSLEGDRGGQCSWWMVLRHDQDGR
FT                   SMVEGDHGGMTTMEGPWWMGSWWKVSMVDGMTKMEGPWWMGSWWKGSKVQGGWGQGPRS
FT                   MLGRVMMEGPEVTVVEGGILKSGGGISEKKKRCGGEKERRRENLGKRGYLYFFQWLKDR
FT                   KALGSATSSDKMGRNAGEPIETRRDTRNLPGRSFPTGPGCLLGYIHPWTCRGYAMEDIW
FT                   ILRTVHFENTNQIILARM"
FT   CDS_pept        join(complement(881135..881341),complement(881071..881081),
FT                   complement(880930..881002),complement(880789..880874),
FT                   complement(880460..880738),complement(880251..880396),
FT                   complement(879564..880189))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000236991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978325"
FT                   /orf_name="Pc13g03730"
FT                   /product="Pc13g03730 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91442.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniParc:UPI00018306BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H220"
FT                   /transl_table=1
FT                   /translation="MSGFNELVDTDLRGLDSDRKWSLQPLLRSAERSHSKMPGIRKIPL
FT                   RAIGIIAFIALLNIIVWVAAAIVLSYHHSLVSTAALAYSLGLRHAFDADHISAIDLMTR
FT                   RLLATGQKPVTVGTFFSLGHSTIVIITSIVVAATAAAVSERFDSFSTVGGIIGTSVSAA
FT                   FLILLGLMNAYILYKLVKQMEKVFNLPEGHEDEAWKIEGGGILFSVLKKMFKLIDRSWK
FT                   MYPLGILFGLGFDTSSEIALLGISSIEAAKGTSFWVILILPALFTAGMCLLDTIDGALM
FT                   FSLYIQPAANFLPQKPTSDVSDTSSTATDPDELPQSQDNHRDPVAFLYYSIVLTTLTVI
FT                   VAIVIGIIQLLTLILNVTDAKGKFWDGVQVAGDYYDAIGGGICGCFIVFGLLSVLVYKP
FT                   WRRWMDQRHGKHVANDVERYTDDDISRGDAPGYGAIVTETSRTQHEGTATEVTGKGPAS
FT                   RVAVKETGESRLEDHIM"
FT   CDS_pept        join(complement(882922..883629),complement(882466..882759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950881"
FT                   /orf_name="Pc13g03740"
FT                   /product="Pc13g03740 protein"
FT                   /protein_id="CAP91443.1"
FT                   /db_xref="UniParc:UPI00018306BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H221"
FT                   /transl_table=1
FT                   /translation="MGGMRLPRPTGIYVPSSPRTLTNDMISPPLSPEFSFDSETVTPSL
FT                   LPALEYISSKLQQRMMHVTLLIGRGKPYPTGQPSDLMIIPIHTIEPQAWRVLERAIAKA
FT                   SKKFSLGPGWTDAISRSQYERQANDHLVKQSILQNEVIFSQEGLTLLNMDRIYTFKRRM
FT                   CILSTRPFSRNNEQSMSSCIRLLHRIVADFSGRPFSKAFFHRIYEQLDVPDEQLTAVAV
FT                   AYKNVHNQDAIILPPKVERVLLKPKADPIPIRVKAERHREVKRSPIQTVRGRRHPPPSM
FT                   RGHNKRGPKTPLSASDVTPITRNEWNILVSQDIRVQPKVTKWTPSPTVLAAA"
FT   CDS_pept        join(complement(885890..886021),complement(885669..885816),
FT                   complement(885456..885589))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978326"
FT                   /orf_name="Pc13g03750"
FT                   /product="Putative uncharacterized protein Pc13g03750 "
FT                   /protein_id="CAP91444.1"
FT                   /db_xref="UniParc:UPI00018306BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H222"
FT                   /transl_table=1
FT                   /translation="MSAKLNPGEMCLFGVWAFEPRRFAYGSANPYLSWRVCAWPGRIKN
FT                   WPGVAQVALVSRLSEQRYIRGVKASSISATYLQNIFWHTPSAEEVDIPVGMPSINSKFL
FT                   NPFATFATSFCTGECPNAHCSETKSDGGDKRQG"
FT   CDS_pept        join(887007..887163,887214..887271,887338..887344,
FT                   887397..887557,887607..888936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978327"
FT                   /orf_name="Pc13g03760"
FT                   /product="Pc13g03760 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91445.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018306BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H232"
FT                   /transl_table=1
FT                   /translation="MEKSIKAEEYPDHTVAREFSEDGKIEQGQSGLNDPNHVELHRALK
FT                   ARHITMIAIGGAIGTGLIIGTGEALAKAGPGAILISYAWVGFIVFLVMCALGEMAAWLP
FT                   LPSGFTGYAVRFVDPALGFTLGWTYWFKYIILSPNQMTAGAMVISYWIPPEKVNAGVWI
FT                   TIFLVIVVAINYFGVKFFGEFEFWLSSFKVIVILGIILMSFILMLGGGPDHDRKGFRYW
FT                   KEPGAFNTYKMDGAPGRFLAFWSTMVSATFAYLGTELVGVTVGEAQNPRKTIPRAIKLT
FT                   FYRILVFYVTSVLLVGTLVPYNSPKLLFALSDDNKKKGSAAASPFVVAIELAAIPILPH
FT                   ILNACILLFVFSAANSDLYIATRTIYGLAREGKAPKIFARTDRRGVPVPALAISSIIAL
FT                   LGYMNVSSDSKTVFKYFVNLVTIFGLLTWISILVTHIYFVRARKAQGVPEESLAYKAPL
FT                   GVAGSYFALGFCILIAFTKNFDVFIHNPKTYGNFDYKNFITAYLGIPLYLIMIFGYKFA
FT                   TGSKGVDPMTADLFTGKDEIDREEALYLARKEAETEKHNNAGWFYRTFVSWLF"
FT   CDS_pept        join(complement(890839..891213),complement(889594..890787))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950882"
FT                   /orf_name="Pc13g03770"
FT                   /product="Pc13g03770 protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91446.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI00018306BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H233"
FT                   /transl_table=1
FT                   /translation="MRLFSPILVASTLIPLISAVPAGSSITPPPPLQPSYFTHSSPRPW
FT                   ARLRDWIIGSIWDIDHKHRSSKHSSPPSNIHDRYGSDVVLRFHLRQPDEAEALASASQV
FT                   LFLDIWAITSEFVDIRLADDMIPSLLDLLPLTLRTSYTPLMDNLADEIYASYPSRHRSD
FT                   SDFKSGLASAELKTISNCDLFFQEYQPLSVITQWMRLMASMFSSHVRMTSVGVSYEGRD
FT                   IPALRLGTSHNTETTSGPRKTILIVGGSHAREWISTSTVTYVAYSLITHYGYSPAVTRL
FT                   LHEYDWVLIPTINPDGYVYSWESDRLWRKNRQPTGLPLCPGVDLDRAWDYEWDGESTRS
FT                   NPCSENYAGAEPFEALESQRLAQWAQNQTAHGGAEIVGFLDLHSYSQQILYPYSYSCSS
FT                   VPPTLESLEELALGLAKAIRQTSHESYDVTSACEGILTQGAAAGITSGGSALDWFYHKL
FT                   HTRFSYQIKLRDRGSYGFLLPSEHIVPTGKEIFRALLTFGKFVWGEEASDISLEDMTGD
FT                   QIPLN"
FT   mat_peptide     join(complement(890839..891156),complement(889597..890787))
FT                   /db_xref="UniProtKB/TrEMBL:B6H233 "
FT   sig_peptide     complement(891157..891213)
FT                   /db_xref="UniProtKB/TrEMBL:B6H233 "
FT   CDS_pept        join(892017..892383,892452..896281)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214195" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129524"
FT                   /orf_name="Pc13g03780"
FT                   /product="Pc13g03780 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91447.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000183077D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H234"
FT                   /transl_table=1
FT                   /translation="MHWKGLRLVADGKRQSTMEPQGQSRRSEHLPRPYPPAEPRLSESI
FT                   PRTPGLSESVNPELPAPDDNGSNHGVAQPDFAGPSSDRSSVRHKRFSFMRLRHASDPQL
FT                   SKSYVRAGQDTPPVPSLPPPKIITTAPTSQELDQPVKQRPRLSFRPSSRKQSMEEMSRR
FT                   SMEQPAKPRRRGQGSTDSQVTDSTLAMSQSITEEPGRLSTNSLRGNPQPNDSQRSSVID
FT                   PRFSESSRSDQSYGDQTITRSISPRDGQSATAAKRFRMPRLKRTRSPLFPLPPKVSHPT
FT                   GVVDNRPKFAPADTPKSETLDGHDHVSPLPSPSRSTVGLAASSNVTPLFRNDSTNSARS
FT                   VRSNPSLKNRGRSSTMGSLAENHDDLSIPPYLASSARTSTSTSGRKSFGDMFNITQRLR
FT                   QNSSPPSPRHGSPTIGGASTPISKQELPTIPKREESDTPASYLTRLEENIPRGMIAGVL
FT                   AQSDEEFYKVCLRKYMRTFSYFGDPLDMSIRKLLMEVELPKETQQIDRFVQAFADRYHE
FT                   CNPGIFTAPDNAYFIAFSLLILHTDVFNKNNKRKMQKADYVKISRSEGISEDILECFYE
FT                   NISYTPFIRVEDANLPDRHLAKPRRTLFKSTSSENLARIAREPVDPYSLILEGKLGSLR
FT                   PSLKDVMDLEDTYNHFGTAGPPDMDALHQAFTKSGILQIISLRSRPDAFMPASLGSPLD
FT                   SNPGLVDIKVAKVGLLWRKDPKKKKARSPWQEWGAILTFSQLYFFRNVNWVRSLMAQHE
FT                   AYVKNGRRGTLVFKPPLAEFKPDNIVSTGDTVALLDSSYKKHKHAFIFVRHNALEETFL
FT                   ASTESEMNDWLAHLNYAAAFRTTGVRTKGMIATNYEGQRYRKSQRLSSISSQKSHQSTD
FT                   IEPHSPSIDTDIVAEFVAARQQLMSQKIRERNEKLAMSQKQLDDLLQNARHLQVLTPLH
FT                   ARARENVIMAAGRLSAKIKWVRQDIWRSKCYRQVLLRDLGEDEEAVESRVGSVAEPTPS
FT                   HSDGARLASLSGPSVTSEPSVEKAGSIVHTVSSADTPEPNMAQTEQPSEAGLLPKPSND
FT                   ELRRPSIPGSATSADIARVGRRRSAVALPERAKSYSPDPATIKLEREASVLSRASRWDG
FT                   ASLASRTSKLTTPVSFDDGEERVLREAGLLELPASPSTQKDDETASNGLPGKDTEGETN
FT                   PKDKSDRPSRVRRSLHRTLRDSHAHRTHSHSKKKRGSVSSIGQEEDDQVSGDGEVLPRK
FT                   APSFTVHGKKASIVTFGSEWQNMPPEERLKLRKPTPHEESRVSDPAILDSGESIMTDRS
FT                   PERPHSARRMSTATGLSVRTSDDPADFTDAQEEQEEQPEEDIGAPGSPVVTSLPTPHPL
FT                   DTQHTPYSPSSTIYGHLSAPRHDGSPSPSPSSTSISERIVDTPSSENLREQAVGA"
FT   CDS_pept        join(897002..897553,897635..897890,897948..898279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214173" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672462"
FT                   /orf_name="Pc13g03790"
FT                   /product="Pc13g03790 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91448.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000183077E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H235"
FT                   /transl_table=1
FT                   /translation="MAHSKRNTSLPHFTSYERGLLRSTWGTKRSAIGRDSFLSFGSCRL
FT                   CLQPARAPVVACASNGDLFCRECAISDLLAQRQEIKRLEKERDEARKRIAGDEERSLAE
FT                   MKERDLRDFELVSMGLENKGGSGVGTKRKAEESEALEKFKAREVEVDGKRKRVFELGEE
FT                   EMARVAGEEKERLRKELKMEKSSSKSALPSFWVPSLTPNTDANEIAANKTVKLTPVCPG
FT                   STDESRHSYSLKSLVEVNFTEEKASDGTVSRVCPSCKKNLSNGLKAMLTKPCGHVICSP
FT                   CVTKFMIPHDHHIPDPHASKEEQEKNAALHGQVLCYVCETDVTAKSTPDGNGSGNNKKS
FT                   KKKDKDAIQPGLVEVSSEGTGFASKGGNMGKKTGVAFQC"
FT   CDS_pept        complement(898483..899466)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129525"
FT                   /orf_name="Pc13g03800"
FT                   /product="Pc13g03800 protein"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91449.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="UniParc:UPI000183077F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H231"
FT                   /transl_table=1
FT                   /translation="MSKATLAVIAAASAATGAGVTALLFSGKPSKPQQETLSPTPTTQN
FT                   PKVPVPSTIPSPTLASKLATGPVDAAGILQYGFPGPIADELSSLPLHGAYDRRTRNPSW
FT                   VAEHITPESLRMNNADRKRSTFFEDTTIPAMFRAKLSDYFRSGYDRGHQVPAADAKWSQ
FT                   DAMDGTFALSNMSPQVGEGFNRDYWAHFENFCRDLAKRYPSVRIVTGPLYLPHRDPDGK
FT                   WRVNYEVIGNPPNVAVPTHFYKVIYAEDGTNSPTSKVALGAFVLPNARIANDKRLTDFE
FT                   VPLEAVERASGLEFGSKLDLSRRRRLCQEVSCSITVREFNNANKRS"
FT   mat_peptide     complement(898486..899400)
FT                   /db_xref="UniProtKB/TrEMBL:B6H231 "
FT   sig_peptide     complement(899401..899466)
FT                   /db_xref="UniProtKB/TrEMBL:B6H231 "
FT   CDS_pept        join(900139..900190,900239..900369,900420..901039,
FT                   901191..901775)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(902888..903013),complement(902515..902619),
FT                   complement(902381..902470))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672463"
FT                   /orf_name="Pc13g03820"
FT                   /product="Putative uncharacterized protein Pc13g03820 "
FT                   /protein_id="CAP91451.1"
FT                   /db_xref="UniParc:UPI0001830780"
FT                   /db_xref="UniProtKB/TrEMBL:B6H223"
FT                   /transl_table=1
FT                   /translation="MLKLPTSGRPTAWSATTTSRLACQFRFSASYMAAGWLEDSAIAPP
FT                   RGDALSVDEICSVGTPWCKESDKVNYDPDSKQRNVVTARVLPIMTYHVPDIVLGRWQNL
FT                   TA"
FT   CDS_pept        join(903427..904204,904234..904370)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825159"
FT                   /orf_name="Pc13g03830"
FT                   /product="Putative uncharacterized protein Pc13g03830 "
FT                   /protein_id="CAP91452.1"
FT                   /db_xref="UniParc:UPI0001830781"
FT                   /db_xref="UniProtKB/TrEMBL:B6H224"
FT                   /transl_table=1
FT                   /translation="MNGQLPPYYALETILSELSEVPELSGFIVVKDNELNAIEKPAETI
FT                   TIIDFYRYSTAILDYVKSSNTDSLALHTEALDSWGTEIICILLTNLHAKSVPSPFCALL
FT                   SGFPFTKTWNRFVEYYLADPGVEFPREKFPDAKALAEATLRQFSRRNLRAVTRFGVGAI
FT                   IRPVEATYQDEFYRSLHTVLGYAMNVTSEWSPDGVGRIDFRLSSVRWGIELLREGDRLH
FT                   DHCQRFTTDGAYGKWIQQGLLEDWLVIDCRTSSPRSYAGTAHASIEIPDTKLWRAVFAP
FT                   DFSDVEVRDQYNQVVVDRFALTE"
FT   CDS_pept        join(complement(910023..910473),complement(907667..909970),
FT                   complement(904935..907582))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950883"
FT                   /orf_name="Pc13g03840"
FT                   /product="Pc13g03840 protein"
FT                   /protein_id="CAP91453.1"
FT                   /db_xref="UniParc:UPI0001830782"
FT                   /db_xref="UniProtKB/TrEMBL:B6H225"
FT                   /transl_table=1
FT                   /translation="MVSSTAISCVEGFKSKESDQVIGRNVDAAFVTYAKRFSTHWNCVV
FT                   DAHTAKLVQDSPLIYSSPELGSLRQFLGVQDRPLQFILDSRAHSLAEGSFEWFNNTLYD
FT                   FSVGSSPAMLVSGGPGSGKSALAQWAVERLQQSAEHDSWNVIPYTIRADIPVATLPLRI
FT                   LKGVLHQMLDHSVSDKQTQEAILAEVARAAQGAIDGAGDDAVEASLWRGIRAGLATNIQ
FT                   YMFVVDGIDQIRGGHANAVAYLDRFCEILSEQNAGSKMIAFTRPLTSKVSSKGVHQLTL
FT                   QTSQTKTDLVAYVNKMLASSANFDTHKGNQLQAAVSAIVARSQGSFSWAEMAVSYAKQQ
FT                   KTLSQAVASIQALPQSMSELIDFHSKSLDFSQQGTVNVVSWLVAAERPLLVEEIEHLLN
FT                   VDPKGPSYSPNQSTSSYDILNALSPLVMTRDGVVSFAHTCIRDHVIKQAKSSGGQSKLS
FT                   IRDAHYDLLTRCLSSVHLNVREEVDISMDRLGIEERNHLFDKYVVLEYTARYWLSHLLS
FT                   SPLVTDDEEFQFNSSFWKIMPATVLFARLELTCRESQFTRSSVVELYRLASDIRRLVLG
FT                   EKSIALLQSLVLSARVSKLAHASHADETCYEAWKLSQELLGQSHPVTLSCSEMMVQSFS
FT                   ERGTITSQQEDIMKYLILTDSEITGVEFNQRLKYLGMIVSMYKSRNDNQSALFISKHFY
FT                   QQILQKYGTNSRQSSETADFLTSHFSTTGTDEMSRDIARTKYDNMVRTMEVTDERRISY
FT                   TLYMAKMYEDQGDLAHAQAVLSSLWAGLNSRDIDSVDMMDKKANVALVYYQFLRRQGRN
FT                   DESEVIIRELVADLEVTGIHSEEMMQRVHLLRAETREMLMYNLDRSLAILMWRYYKETH
FT                   QEYSEDSTALALSIAQSMANAVSIESASSLSSRDRKLLIELLDVISATSECAMAVLQHI
FT                   WPAVEQAKSHQKFSPELAPPAADLALVLAYCHFRRLHLEQATAVYENAFGSLISSAGVP
FT                   VPSVMAVAKAVVEFHETTYQFTNALTLLHTMSNFLAARLGEKHEHTIENMYSEAALATR
FT                   LEKNSEAKSIYQRIFNATSHQNTVSPEGMDAAIALINLYEKEMQWDSALHVYRSLWPTL
FT                   VVEDNKVDTYDHDLVDRMLEKTYLGYMSILTTHKRADFSERYRVASEYVMTCRHLHGAT
FT                   SEKTLNATLLFAELCESNDAHVDQAISLYKLPLETSEWVAPSQSSKGLDQMTTPLPITL
FT                   KHKLAQLFVRKHDSTVEARSLYTEEFQLAKKNQGYFSTTTLSWLRELALAHSRQGTSTS
FT                   VQQGNAILHAYSTDVLHAGGDTETIGDWARRIASIYLECGFIEGGNNLLDELRHRVVYG
FT                   SESSAVDLSDRRDAVFVAAFEEVFGRRASYDQIMAEMAREMRTSQAFSKSLSSHDFIPT
FT                   LITGHKLYNLQISQKRVRAANDTKDKLYDYFCSNLSATNVADKEIVQQFYQICLREVHR
FT                   ENCNMSILTTTTNLVRDLCNSSRFQEASILTGVLHSFLHLTDGLNNQESINTATQLCLY
FT                   LSGHKANKCTDEKTYQAISTKSKLLLQEIMATSKSMGIEMVDLPFNHLNDIITLLGQYE
FT                   MFDELEAILTQLWTSRIVQRTWTPDVVVWIGRRLVETRFCRGSVDSAIQLCRDICYNLR
FT                   QVWGSCDPVTLDMTKLLSALFTASENYQSAATLHEGILYDLLGDSGAVDHANGADTASQ
FT                   HMELLRRSQARLGAEQTSSRPSAHAELFQSVADRFGVQSEQIKSVGEANGGEQFGVWSK
FT                   PRRFSIDVEDMEEEGQTHRNHLRESSGAGLGGTGSQRRISVQAL"
FT   CDS_pept        complement(910677..912650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950884"
FT                   /orf_name="Pc13g03850"
FT                   /product="Pc13g03850 protein"
FT                   /protein_id="CAP91454.1"
FT                   /db_xref="UniParc:UPI0001830783"
FT                   /db_xref="UniProtKB/TrEMBL:B6H226"
FT                   /transl_table=1
FT                   /translation="MFAKAKGILDKSSSIRNEVNQGNYNGAKDIVTKGQTTKESTSQGD
FT                   KANEPVDRNSSTRDEANRGNSNGAKETSTQGQATKESTSRGAVGGAAGGAVGGVAGGAS
FT                   GSAAGMNKDLNRENVQETGRQTSQGGIGQDNTGTSSTSHTKVEQRDMGTERREASQKQQ
FT                   HSTDAKQATGSQQYDRRGSVLAGELAANYDIRKGPITTPGTFQEKNFHTPGDKPILIQR
FT                   GGTNSKTVPRGENTDNSQFAGAGAGSGNQASLSQEKSGNPVAGGDYSKESLENEIHDYE
FT                   NISPDVFSDGTTSKDLSKKAADQDVGKYHIDRKQLDKQGSQPSQKAGTSEAAAAAAAAT
FT                   AAAGGGYGMSKGADNQTSTTRKQRKRHSVSGTNATRAEDPTSTSQKSHVASTVGEQDRV
FT                   GGQGAGASSSGNRGGYTYARAVSDHGYTPKTPTNTAYSTTSGSNQTSGLRSTTTGQTNS
FT                   ALFNNGATASNKAGIASGGVLGLHQDGSYGLSGNENSGVNQGSIVGGAGTREAGAYDTS
FT                   SNNGFNTGVTHASSGANNSVGSGMTSKRIVRQLSGSGYKVTILQEKVQAVSQKCKAQLG
FT                   LSSTQISKRSPNVDVFFDAVAAERLRWMPQDGSRLDCSLRWASRLAYAVDALRESVGVF
FT                   APAANEAASLIWGFSILLLEVS"
FT   CDS_pept        join(complement(913958..914112),complement(913471..913601),
FT                   complement(913292..913357),complement(912843..912949))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672464"
FT                   /orf_name="Pc13g03860"
FT                   /product="Putative uncharacterized protein Pc13g03860 "
FT                   /protein_id="CAP91455.1"
FT                   /db_xref="UniParc:UPI0001830784"
FT                   /db_xref="UniProtKB/TrEMBL:B6H227"
FT                   /transl_table=1
FT                   /translation="MVHAGEGGGDEIVFEHDTGDLVAILQIKRLARQASLERHYTSTCA
FT                   KEGLSCGHDLTSSMPGHPEMTLHMFGEMTEHSKDETPTDQRLDLRLSGLAYSGKMNGFG
FT                   AIEFNQNRLSRTPHCGPCDPSKDMGWLSWIPSKLFPQCGHHRNNSMMQ"
FT   CDS_pept        join(complement(915608..915667),complement(915393..915512))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672465"
FT                   /orf_name="Pc13g03870"
FT                   /product="Pc13g03870 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91456.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniParc:UPI0001830785"
FT                   /db_xref="UniProtKB/TrEMBL:B6H228"
FT                   /transl_table=1
FT                   /translation="MGKVHGSLARAGKVKAATPKVEPQEKKKNPKGRAYKRVLYTRRFV
FT                   NVTMTGGKRKVHIE"
FT   CDS_pept        complement(916205..917551)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672466"
FT                   /orf_name="Pc13g03880"
FT                   /product="Pc13g03880 protein"
FT                   /protein_id="CAP91457.1"
FT                   /db_xref="InterPro:IPR018612"
FT                   /db_xref="UniParc:UPI0001830786"
FT                   /db_xref="UniProtKB/TrEMBL:B6H229"
FT                   /transl_table=1
FT                   /translation="MPANLPYGLNLPNKSLAATKPGNALGQKRKNIFDDDSDEDQQTGD
FT                   GAIEISTIGGLEEPATNKKPSPSAGPPPKRKIQFGSGPKPTAKPLGKNSLFADDEDEDE
FT                   EREKDQQGAMNLGLNQAKSKKPTAPAQIYTNLASMHSSNVQAKAAEELDPLVYSYDEVY
FT                   DSLHAKPAKVSVETKSDTPKYMQNLLQSAEIRKRDQLRAKDRQLAREREAEGDEFEDKE
FT                   KFVTSAYKAQQAELRKAEEEEARREKEEEERRKKSGGSGMIGFYRDVLSRGEARHEEVI
FT                   KAAEETARRVKAGEIIEETEDKEDKSDAQKAEDLNAHGARVVVNDEGQVVDKRQLLSAG
FT                   LNVAPKPKAPASAAKAGVSRPTVGRPGAGAGYQGGRAAQRARQTDMVASQYEERARQEE
FT                   EAEAAKQREIAEKSRSRKTEKDVSSAKERYLARKREREEAAAKEKSKGA"
FT   CDS_pept        join(918117..918394,918567..918933)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950885"
FT                   /orf_name="Pc13g03890"
FT                   /product="Pc13g03890 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91458.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001830787"
FT                   /db_xref="UniProtKB/TrEMBL:B6H230"
FT                   /transl_table=1
FT                   /translation="MAAASKAAIPSSSAVLGSISTLNNPSLLKMSYYFTILSPTDTPLF
FT                   NIAFGTSKGGGDGIARFRFPETAQYMNQFIIHSSLDILEEAQWTNGGMYLKHIDTYPPA
FT                   AAYITAFLTPSGARFLLLHQPPNLPSSTSSSSGLGSSSLLGTAGSTTRASSSSIAANPT
FT                   SPQTEEAVRQFMNEVYENYVKTAMSPFYKQGMEIKSPVFRTRVTAAGKKWL"
FT   sig_peptide     918117..918179
FT                   /db_xref="UniProtKB/TrEMBL:B6H230 "
FT   mat_peptide     join(918180..918394,918567..918930)
FT                   /db_xref="UniProtKB/TrEMBL:B6H230 "
FT   CDS_pept        join(complement(920615..920724),complement(920126..920550),
FT                   complement(919937..920068),complement(919381..919883))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950886"
FT                   /orf_name="Pc13g03900"
FT                   /product="Pc13g03900 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91459.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="UniParc:UPI0001830788"
FT                   /db_xref="UniProtKB/TrEMBL:B6H277"
FT                   /transl_table=1
FT                   /translation="MADSTDLNLDDAPSDLQDIPELAMQLVPPPEGTYPDKATLLAAVQ
FT                   DHGKEHGYNVVVKSSSTPTEKKPGRTAKVWLRCDRGGHYRPRNGLTEETRKRRRTSRLM
FT                   DCPFMLVAAGSPGIWTLTVLNAAHNHGPVIEKPRQVPHHKVRKGQLPAVPYDWPHDASF
FT                   TPYTTALVIIDMQKDFCLPEGYMGYQGYDISAAQALIPRLQRLLHAFRSGGFPVYHTRE
FT                   GHRPDLSTLSSREAYRSRNNASGLGIGSPGPMGRLLIRGELGHDTVDELYPLPGEPVID
FT                   KPGRGAFAHTDFELLLRNKGVKNLVIAGVTTDVCVSTTMREANDRGFDCVVLDDGTAAA
FT                   EPSLHLGTMQSVKMEGGIFGTVAKLEDVIHAVDNFKTVTMKKLAPQMTV"
FT   CDS_pept        join(921660..921896,921953..923509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950887"
FT                   /orf_name="Pc13g03910"
FT                   /product="Pc13g03910 protein"
FT                   /protein_id="CAP91460.1"
FT                   /db_xref="InterPro:IPR006964"
FT                   /db_xref="UniParc:UPI0001830848"
FT                   /db_xref="UniProtKB/TrEMBL:B6H275"
FT                   /transl_table=1
FT                   /translation="MPAVDESTSERKHTSSSYRDELAHYKAQYELLEAELADFQSSSRE
FT                   LETEMEKDIEASEKRERQLKEKLDTMRYEVDEWKSKYKQSKTEGNSVQNNLQKEITTLR
FT                   EANRTLQLKLRDIEVANDDYERQARNTTSSLEDMESKYNIGIERQVLLEEEIRSGEQER
FT                   EQLRIDNQRLRDELSDLKIETEIIQEKLRNTEGHGMRRRKPTPLYHRSPATPQSLEIFD
FT                   RSPGTATSSPVFATPPAKSSLASSTATPPSPPISESSVNMRKSINAHSNSTPTFPRQRA
FT                   AGADPVNSRTLHARTQPRTTHSRTPSLAYSNGAYSTGNGNSSGNGRSTPSMSISSRNSL
FT                   TRMNTSRPPGLPKSGSLFQIRGLIGKMQKLEERVQSAKSRLPAPSDTSSRGSPRSGSVI
FT                   SDTPIVPSSITVRRDSRKRLSNSSLGSSARDSESTPSYPPQGRQSFGRTGESRPSSRTS
FT                   YSSRSSFSQSVHSGVPANARPESRSSRPGAKTPLGHYSTNPMTEGRRPRSSLSNHAGQL
FT                   PNIAGMSLIDEDQDITTPTTSQISQEIQRPSVTTTPTPIVKKRTISGIPAPRSFKTSIG
FT                   PGTMPPPPNRKTQVSDLGETF"
FT   CDS_pept        join(925189..925335,925416..925681,925752..932160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978328"
FT                   /orf_name="Pc13g03920"
FT                   /product="Pc13g03920 protein"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAP91461.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001830849"
FT                   /db_xref="UniProtKB/TrEMBL:B6H276"
FT                   /transl_table=1
FT                   /translation="MGSTMGNSSAVTKHDIPSHFIGGNALESAPPSAVKDFVAAHDGHS
FT                   VITSVLIANNGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLTANADYIRMADQY
FT                   VEVPGGTNNNNYANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGP
FT                   PASAMRSLGDKISSTIVAQHAGVPCIPWSGTGVDAVKLDENGIVTVEDEVYNQGCTFSP
FT                   EEGLAKAKEIGFPVMVKASEGGGGKGIRKVENEEDFPALYNAAANEIPGSPIFIMKLAG
FT                   NARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKQPTFQAMERAAVSLG
FT                   KLVGYVSAGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPL
FT                   HRIRDIRLLYGVDPNTSADIDFDFSKEESFQTQRRPQPKGHTTACRITSEDPGEGFKPS
FT                   SGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKEL
FT                   SIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDQLISNKLTAERPDQIVAIICGAVTKA
FT                   HLASEAGIEEYRNGLGKGQVPSKEILKTVFPVDFIYEGERYKFTATRASLDSYHLFING
FT                   SKCSVGVRALADGGLLVLLSGRSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPS
FT                   PGKLVKFTVENGEHIRSGQSYAEVEVMKMYMPLIAKEDGIVQLIKQPGATLEAGDILGI
FT                   LALDDPSRVKHAQPFTGQLPELGSPTVLGNKPSQRFFLLHSILENILRGFDNQVIMGTT
FT                   LKDLVEVLRNPDLPYGEWNAQSSALHSRIPQKLDAQLQNVVDRAKARKAEFPAKQLQKA
FT                   IVRFIEEHIGPADAELLKTTLLPLVQVINKYMDGLKSNEYNVFIGLLEQYYDVEKLFST
FT                   HNLRDEDVILKLREENKDDITGIVHTVLSHSRIGSKNNLVLAILDMYRPNQPHLENVGT
FT                   YFKPILKKLTELESRSSAKVTLKAREVLIQCAMPSLDERLSQMEHILRSSVVESRYGET
FT                   GWEHREPSLDVLKEVVDSKYTVFDVLPRFFVHADPWVTLASLEVYVRRAYRAYTLKSID
FT                   YNASTEQPFLSWDFTLGKLGQREFGVLNSTQPSAPGTPIAEVNPFKRINSIGDMSLFVS
FT                   DAASDPVRKGVIIPVQYLEDAEEILCKALEVFPVGGSNAKCPSEQGLIATLEGKRRPAP
FT                   KPVSDSELTGVCNIAIRDIEDMEDADLVAQMKQLLADNKDELLARRIRRVTFICGKQGV
FT                   YPGYFTFRGPNYEEDLSIRHSEPALAFQLELGRLSKFNIKPVFTENRNIHVYEAIGKGP
FT                   ENDKAIDKRYFVRAVVRPGRLRDDIPTAEYLISEADRLMNDILDALEIIGNNNSDLNHI
FT                   FINFSPVFNLQPVDVEQALAGFLDRFGRRLWRLRVTGAEIRILCTDPATGMPYPLRVII
FT                   SNTYGFIINVELYIERKSEKGEWIFQSIGGTAKLGSMHLRPVSTPYPTKEWLQPKRYKA
FT                   HLMGTQYVYDFPELFRQAFQNSWTKIAEKIPSLYEKRPPVGECIDYSELVLDDTDNLVE
FT                   VSREPGTNTHGMVGWIITARTPEYPRGRRFIIVANDITFQIGSFGPQEDRFFHKCTELA
FT                   RKLGIPRIYLSANSGARIGVADELIPFFSVAWNNPEKPEAGFKYLYLTPEVKKRFDASK
FT                   KKEVITELVNDDGEERHKITTVIGAKDGLGVECLKGSGLIAGATSKAYEDIFTITLVTC
FT                   RSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNGVS
FT                   HMTANDDFAGVEKIVEWMSFVPDKKNAPIPIRPWSDTWDRDVAYFPPPKQTYDVRWLIG
FT                   GKEDVDGFLPGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVENVTPADP
FT                   ANPDSMEMIATEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWRGFSGGQRDMYNE
FT                   VLKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVVDPTINPDQMEMYADEDSRGGVL
FT                   EPEGMVNIKYRREKQLDTMARLDATYGELRRSLADTSLTNEQLSEVKAKMAAREEQLLP
FT                   VYMQIALQFADLHDRAGRMQAKDTIRKPLQWVNSRRFFYWRLRRRLSEETIVKRMVAAS
FT                   APAASGVGATGESLRTAHLRTLHAWTGLLDEELEHDDHKVATWYEENKKVVQSKVESLR
FT                   TDGVASEVAQLLIGNKEGGLRGVQQVLSMLPVEERENVLKYLGSA"
FT   CDS_pept        join(934229..934502,934551..935468,935527..936083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950888"
FT                   /orf_name="Pc13g03930"
FT                   /product="Pc13g03930 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91462.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183084A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H278"
FT                   /transl_table=1
FT                   /translation="MIVVYKKIKKRNERKRLNSASNTDNAIELNPVNPRLDRKKKKTVS
FT                   PEQVAEKRRRNVYRWKIILGLFSPYCLQALDTTIIASALPFIAEDFNQIKQLNWIISVF
FT                   NLTSAAFLFFWAQLTDLFGRHIILQSAIFIMMIGSAVCTGAPTSSFSVLLLGRALQGIG
FT                   AAGVNISIRTILADRVSLAEYAVNWTVFALVSGIGFSIGPVIGGYLTQASWRWCFAINL
FT                   PIAVVAMVIVVFVLRTELQGPQSIPEFEERGTSTRSGRFLARISTIDYGGQMLFLWGFG
FT                   LLILALTWAGGTYSWNSVAVLAPMVIGAVLAGAWVVYERCMVPGALMARVLPRQKAMVP
FT                   WELLRQRDIGLLFLINFSTGIAMFAVMYFMDIYFTLVEGRSSSDAGIALLFFLPGLAAG
FT                   LYMAMFSSNVWPRQTFPALFLGSITSAVGMTVLAWGVQAGRTNIIYGMMALVGHGVGMR
FT                   MNPASMHGLAYFPAMTAQITCLASFAVPFGGLLGLTIMSTVFTNKSGVGQADAKDGVMW
FT                   AFIAMMPVMWLSVLITTFLGNVWVLKEGGHEVVNCSYLWGLIFGRDIVRERRDRGEEAG
FT                   DVELTV"
FT   CDS_pept        join(complement(936654..936787),complement(936404..936600),
FT                   complement(936273..936349))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978329"
FT                   /orf_name="Pc13g03940"
FT                   /product="Pc13g03940 protein"
FT                   /protein_id="CAP91463.1"
FT                   /db_xref="UniParc:UPI000183084B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H279"
FT                   /transl_table=1
FT                   /translation="MISGIAHINLTIPQDTLEQAEEFYGTTLGLTSAPVPELQKGTILW
FT                   FDIGSSGQQVHITFGATDPQSSRHPCFKLSSREELEEIKANIYNHHLRGGPAAPMAADK
FT                   PGETNSGTQGKEYPTRFFARDFGGNLLEFTM"
FT   CDS_pept        join(938225..939691,939759..940127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672467"
FT                   /orf_name="Pc13g03950"
FT                   /product="Pc13g03950 protein"
FT                   /protein_id="CAP91464.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183084C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H280"
FT                   /transl_table=1
FT                   /translation="MTAISPMADPLTVLPPEIVLQILHFTPVSALASLTAASKAWHQFI
FT                   DVTHQDAIYTSEAKTAQPIGGSRDFSFLSDTHSYGKVFEGTESWKDLCKRQTLLARNWA
FT                   KPHPVSQESVLQIGNDPVWRFRADFKRRFFVSTSHAGGLNVTDMDTGLLLWQLPSVLDT
FT                   DGDGVRPHAHLEYQDGMAVFDSEGDSLEVWQTDHEGAKRGEFRRIATLNHNCQTRGFQL
FT                   SYWTLCVVSNEGQGFVYDMTQRPPKLTTHLKIEGGGIGHLDQSEDIVIYSMGAKGYFAY
FT                   NKESGAFLGTLKPSPATEKYHVLPPKAASTSTSAALAGAARIGPTPQPLPPGAFRKDCL
FT                   VPIEVAKGPLSPPDDPTHVRHGEDEWGAGMLNGDLFVGFSRAGRVFICSDFRKALRDEA
FT                   SLAANSSVLECESDGSSFDLGGWLSIRNHRIMFEIQDRIYVVALDDNNKVQNVENPARA
FT                   SYSLLTSSAPQLAVPISYMALADDAIMTTYTTLGWRDSNVPGGIPPPQGRELPRVFPTK
FT                   VIRILSLAPNLSTKSSSASGDTDKSSTADNGSLGASGPHLPSADAWRTQAGLLQLLSML
FT                   GEEVESDQSDGEDEWESMNEDDEEEEEEEEEDEEN"
FT   CDS_pept        join(complement(941167..941307),complement(940623..941117),
FT                   complement(940501..940569))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672468"
FT                   /orf_name="Pc13g03960"
FT                   /product="Pc13g03960 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91465.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183084D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H252"
FT                   /transl_table=1
FT                   /translation="MASQLPMADLITEVNPEDLIFFQKLQESANSAVFKVAFHGRICVM
FT                   KVYHDRGPSDYDPSDLEVNLFVCESTAYQRMKANGLCEREVVPDFYGTITKIQPSLWPS
FT                   LHMFHGDNLPPNAILIEYIPNLKPISLSNFSKDYLDKFRQVLDDIHQAGVLHGDAKPRN
FT                   MMISQGKQDRVLWIDFDSAQTFPEGSLSQRQERWVQEENELVDYFIVALAQDFKEGRIN
FT                   RTASYYYEYFVE"
FT   CDS_pept        complement(941511..942842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950889"
FT                   /orf_name="Pc13g03970"
FT                   /product="Pc13g03970 protein"
FT                   /protein_id="CAP91466.1"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="UniParc:UPI000183084E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H253"
FT                   /transl_table=1
FT                   /translation="MELDSFSSFPTSTTTTTTAMSSHQREIPEDSVASYDTALSIDACL
FT                   ASATEEMLEVTEDLAKDEDILRQTLSVRSTISTSRSFAERMQRAEFFQNTPLVVIGRGT
FT                   CGTIFEIPGTESAYKKGSDKAALWNDANLTNIACRAVTETKTCLQEIFPNVSIPRVPVV
FT                   TGWISENDLENWWRENLRRFPKDTRKTGYLFQVQRILPLPKPCREALIHLYFPKTMRES
FT                   AHEDPDNKACLVRPYLGQRRGERELSNPALSLQNFPLYLDQIEELELEVEAIQFAEEMA
FT                   IGLATIHWKACLDGMDMEFVLGSAATNGELPTVVENFKTVAPFDIPAGDVERRQVHLWM
FT                   LDFDKAEQLCLKKSWKSCCDKMVTAVTANDPYFPNPAAMGTLEQKLWDTFERAYLLAAS
FT                   DLLLTQKALPKEASKYPALFLKAWKKRATELAEDTEGDFVEFGE"
FT   CDS_pept        join(complement(944080..947413),complement(943392..943879))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950890"
FT                   /orf_name="Pc13g03980"
FT                   /product="Pc13g03980 protein"
FT                   /protein_id="CAP91467.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183084F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H254"
FT                   /transl_table=1
FT                   /translation="MSVLRHGGGGGFLQRRLTKLYTDTKTSCESVTTASKALDDPELVA
FT                   LHGSFQKQRDRLLAWGLDWSDASAAQPNDIDESLTAAGFSDVVESVMSSIQELLNDAEQ
FT                   VQHVDAPMLPSKERKVDIPSKDTLASRPVKTQWTEEDITRSNKILNELTGCIDTLYDLS
FT                   RSRRTMASSMSSSRNSARRPRPNLTSPYDSSHGSFSDSKEKVQSPKQMFDTFTYSPTTT
FT                   HRDSPNPFLPLNHLLIDRSALQLYGAAHDNSPPPYEPVAASSNSRAIGRLKSSASHLLA
FT                   STKESHVSVLVEFMPILAESKMDNKSARLEKLQQSLDQLLQNARISHLGLMRFLGYCID
FT                   NSNSRYAFLYQMPVDYFPFLQNPSDLLKELKPKPLVALLPSAEEYRENRVPNLDTRFRL
FT                   AYDLLMSALHLRSQNAIHGNINSSNVIFFPGRSDASDDESGLVPDLRRPYLTSPARFSG
FT                   DGPTPEPLSSAMYRHPEDKRCVEDDGAWAYDLYSLGLILLEIGLWAPVGRLWKMKYDRS
FT                   WFKHRVEDLYVKKLGPKCGGAYLQAVQLCLDAPNFHLSTQPMTDLGLRVPQIYHYPVLD
FT                   LSDPDGTFSFSMNFMYTICKILWSCCRIDIFSAPSAEELDDCLPLALVPTPEPVTIEDK
FT                   VRAYKSSKREMSNYDKKLPTIPADAWSVANEDKLIEKPQKKRTVKRLPHMEIPDEHLQE
FT                   WNFQIMPRVSRLLQKILKESSESCGVNLIMTGESPESAKTTICVTCASVKKVRMALKKH
FT                   FALGRDDWDLIVLRGDIERSKVPRNRRRRPAKARPNVSNDTPFRQRELNPCHQQRPLCG
FT                   ASIGTFQNEEHLPPVSYGGAVIVDGLPYGLTVHHMLEAPSEDEGQDSGPAEFNQDAPSR
FT                   SAGNWPRDTSNIPHPGFRYDYPEDDSSDMNFDFEVSDMEDGDDPSQGLESGYDEFWLSD
FT                   EDSSDDDSIGPDDDDDDTASIGDTAGIEPGEEPRLLVTQPAIDDVHEDFFPSPEDRDDE
FT                   HLASHSLGYVHASSGVRRWTRKGLKHEIDWALIKVDEARMDPRNIILDTTRSSIARPGR
FT                   PIPPQPIFLNQVARMEELGGLQVHCCGRTSGLQTGQISKAMTLVKLQGRHSFSTSFCVN
FT                   GNFGAPGDSGAWVFDRPTGRVCGHVLAWSAKSNTTYISPMEVTFDDIARTLRASVVSLP
FT                   GDPSRSMGYVDPNSPQAAQYRYQAQRLPGDFGRLTFGAGGSPGPPVPPYPHHYPHPQAH
FT                   HPAYGRPPPPPPPPPGSREAHGPVYSGPVPPIPPSLLAGPRNIERQLA"
FT   CDS_pept        join(complement(949681..952672),complement(948061..949622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129526"
FT                   /orf_name="Pc13g03990"
FT                   /product="Pc13g03990 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91468.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001830911"
FT                   /db_xref="UniProtKB/TrEMBL:B6H255"
FT                   /transl_table=1
FT                   /translation="MEPMDYQFRSNADNTAFPDLMNDPAYDEREKGFDDLDTCRICHGE
FT                   ATEDEPLFYPCKCSGSIKFVHQVCLVEWLSHSQKKHCELCKTPFRFTKLYDPNMPQSLP
FT                   APLFAKQALIQCFRTLVTWLRFVLVAFVWLGWLPWSMRAIWRALFWLADGRWSANDNVR
FT                   NQAAQTAQYGLGQLSSNGSAAVTDSITSTISNAATSSTTAVPSARSSILNFAAGEPLML
FT                   TLIKKVIPTLFMPAFTSTVGQGNGQNNVTTSSTKPRYPSWLSDVKFLNSLTPYPTINNM
FT                   IMDTLEGQLITLLVVVAFILLFLIREWVVQQQPMVNIAEGEREAALRLIANDNDRINDR
FT                   FNQGGPRQPEPIPAHPENEVNDEPAEAHGLNNDVLPHFAPHSPALSSNDSEYGPPGSEA
FT                   ELRDYSGNDPEGPPTARALAFRDLVARTHGNHEEMLRILREEAHGDDLDWIVNAITGAT
FT                   MNRDSSAGPSTRPHDLDNPEDLDGADASNLGNGNVEDHPPNADAGPSAQNVDHGPPTRE
FT                   NAIPVPNVQMDDRPPPGITERLFEWFWGDITPVERDAEEPVPEDEEHIVQNPALEDPFV
FT                   RLPNRMENIQPDAAADAAAAADAGLDPNDIDAIEGDDFEGIMDLIGMHGPIFGLFQNGV
FT                   FCALLIAFTVAIGIWLPYLWGKIALVLLANPLELIIGVPIAAFEVVADIALDTLIGVVG
FT                   YLMYWFSLIFKIVLSPFSALLPMGEWIPRDKSVTSASLSLIDASSHRLNKVIKAFLVFH
FT                   ESDIPMFSVLSHQALKLHQARLGAVFQSVFATLKFILHDFPLRLVTLGVPDALSLDLDF
FT                   SHFKNAIGQAQQQLTTFAKSSIFSMPGTRFLNVSAAKAASATAPVDYDLVVWDSKDRVI
FT                   AIFMGYLLAFMVGLLYLRIAGLLSGANRGQRMEGLLAEVLVQAGGVMKVILIIGIEMIV
FT                   FPLYCGSLLDLALLPLFSDATVASRVAFTAASPLTSLFVHWFVGTCYMFHFALFVSMCR
FT                   KILRSGVLYFIRDPDDPTFHPIRDVLERSITTQLRKIGFSALVYGALVIVCLGGVVWGL
FT                   HFALDGVLPIHWSASAPMLEFPVDLLFYNFVLPVVIQSFKPSDGLHDLYDWWFHKCAHF
FT                   LRLSNFFFPERHLEEEGYHVRKTWWAILSRSEGDWEHPVVGDDQQAAAERENRDVYFMR
FT                   DGRYVRAPGSDQVRIPKGNNVFLEVTENNERVDGKVDFADELHGRSSNMFTKVYIPPSF
FT                   RTRIAAFILLIWLFAATTGVGITIIPLVIGRKIIGSYSSTPAPVNDVYAFSSGLCVVGA
FT                   LAYLAYYSSTALNFVRENSGAYLRSPRQAAQTGLNLVLHAARLLYMAQVAIILLPSLFA
FT                   LLTELYILIPAHTLFGDGESHVVHVVQDWALGVLYVQMAIKLTFWQPHSWVAAAVNSVF
FT                   QDGWLKPNASLATRALVLPIVLFTAAAVTLPLSFGFIVRWTIFYSHIGVQPNIYRYAYP
FT                   TTLLVVLSVWMVHLLLRRVAVWRTNIRDEVYLIGERLHNFSEKRARDVGVSRVMTG"
FT   CDS_pept        join(953521..953639,953703..954440,954498..955914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825160"
FT                   /orf_name="Pc13g04000"
FT                   /product="Pc13g04000 protein"
FT                   /protein_id="CAP91469.1"
FT                   /db_xref="UniParc:UPI0001830912"
FT                   /db_xref="UniProtKB/TrEMBL:B6H256"
FT                   /transl_table=1
FT                   /translation="MVVKENGQVADATPKPNGQTRLEKPRKKGFVRWTVGLVVRLCIWY
FT                   TLVTTFLRCPSRLTDLTETSPRVCKPYLIARSHVEPYVTPYYDIYAAPYVDQARPYVDQ
FT                   ARPYVEVFNQQVYTPASKVAKSGYEKYGAPALKQAQVYGIEQWQRQVAPRLQTAQDKAH
FT                   KLYLTEIDPYVQQSVAVVSPYYQLVNTAVLNVYQGHLVPLYARSKPFIGIAYSTGQDVL
FT                   TTHVLPWAQYSWSSAVYFANSSLWPHITGLYSEQVEPQLVKIGQRLASYREGKRLRAVV
FT                   EDVDSSTVQPVTSSATKSQEQIHTTTTVTSTSTPQASPQPTLTPTEQAQQAREKIDSDL
FT                   ERWQEKFALAADKGIEDLEDRIEEIVSALVASSANSHGRSLHTALQSVSAEQLSSIKQR
FT                   INELAASMPEEDAPEIEEATSDLLIGEIRTSAISVRDRAHALREWSISFEDELVRRVNA
FT                   AVNSTLDVLDSIRDLGLQEIGMRWAWMDGVTYKDWAKYHALKAQLEEWRNDIRNVGMNH
FT                   KSVSDARAVASEILDQGMHEAEQAARELVRLKDVGIWKIAAREVSDDFETRTEAPPARP
FT                   KPQEQTKESDEEEAKVDSDDDESSEEVAASMSDDAYEETLSTNEPSAAADAEADFDGAN
FT                   ESVMDDDIVEEEQPPARPAFGVSAADANSHQAPILDGEGQDVMDSPASKSGDTYAVASN
FT                   AVSEAIYGASSTPGVGERAASLASDQYSLAWSAASTVINGTPLSSGEKAYSDASEKYSD
FT                   AVAA"
FT   CDS_pept        956123..957532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825161"
FT                   /orf_name="Pc13g04010"
FT                   /product="Pc13g04010 protein"
FT                   /protein_id="CAP91470.1"
FT                   /db_xref="UniParc:UPI0001830913"
FT                   /db_xref="UniProtKB/TrEMBL:B6H257"
FT                   /transl_table=1
FT                   /translation="MAESSAPAHSQLLSSIESAYSGSVKYATDELESKLRAVRATPTPS
FT                   NAGPLAQISSIASSRLNQGLSLASEQLSQVQPPATTGSLPHGHLDPFVLDAQRRYYEAV
FT                   GLAHDHYSAFVSTASGVVYGSPIPTPTGGSKGIIEEARSQYEQASSLASASLAAVVASA
FT                   SSAMSSADGGKPQSIIEDASSRYNAALSAASSSLSTASISASSAIYGTSTGPVESISSQ
FT                   ASENWESLISKASEQIYGAPTPYLQQVVNNGRAQYEAVQEIVSELIVGKQPSYTESVLS
FT                   KLRAAYETPYPAAAASASSYINEAYGSASSAAASVVSEAPSVEDIIQGANDQLHAAVET
FT                   ASVGIYGTPKGSYQKATDAAADAYSTASAQVSYAVYGKESSYIDVAKDAIENIQSTASA
FT                   AIYGEEPNAMESAAVRLAEAKENAMSQLADLASRLPGSNAASEAVETAASHVKDTTSSI
FT                   KSVAASVKDEL"
FT   CDS_pept        join(complement(958866..958874),complement(958269..958775))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672469"
FT                   /orf_name="Pc13g04020"
FT                   /product="Pc13g04020 protein"
FT                   /protein_id="CAP91471.1"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniParc:UPI0001830914"
FT                   /db_xref="UniProtKB/TrEMBL:B6H258"
FT                   /transl_table=1
FT                   /translation="MAQKAAKSLATRNGAVLSRTHLISAALHLLFLLLHFVFQRPRSLK
FT                   PYLFLAVPTLAIEYYLDRMGRPRYNEDGSLRSAGEDLNATGLTEYMWDVLYWTQGCIVA
FT                   VCLFNDRAWWLWVVIPLYSVYAAYTTIMGVKKGFAGMGGGDAGQEGDVPKSKTQLKKEK
FT                   RGPTMKYR"
FT   mat_peptide     complement(958272..958667)
FT                   /db_xref="UniProtKB/TrEMBL:B6H258 "
FT   sig_peptide     join(complement(958866..958874),complement(958668..958775))
FT                   /db_xref="UniProtKB/TrEMBL:B6H258 "
FT   CDS_pept        join(959636..959972,960030..960203,960255..962098,
FT                   962177..962248)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950891"
FT                   /orf_name="Pc13g04030"
FT                   /product="Pc13g04030 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91472.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830915"
FT                   /db_xref="UniProtKB/TrEMBL:B6H265"
FT                   /transl_table=1
FT                   /translation="MALSTGHVASQLRHLIYYQLDNNLIRNALFLASRLHAYEPRSFEA
FT                   QFLLALCHLHNGEVKAAFECSQASGSRGLHAGCAYVFAQACLDLGKYLDGVTALERSKS
FT                   LWASKNHWNKHSETQRQHLPDAAAVYSLQGKLWHAHKDLTKAVDCYVEALKLNPFMWDA
FT                   FLGLCETGVNIRVPNIFQLSPELLAIISSSPEEIATAPDNVAYEEGTFPVQPPGNPESD
FT                   PFMVSASRGESDATFGSSALWEKLNGSSANFAAIAQPVFHDGMETPGAQSSGSDDFRIA
FT                   NGVTDPEAGWEAPLAPARKTRTIQTMSLDHTGQPPPRMRPTGIRPRHKTRTEPETQPTA
FT                   PVERDPSLVSRFGDRKRTVSGQVAHPLPSSQPTEPGAPQRRSVRLFNQIKPTTSKLSNG
FT                   TLTGRDGREMKKLRGGPTKGRAGSAPTVGRVVSGNRKPVETPDNDGKDNRTGLSQSHST
FT                   APPLPKNAEKTKELEALDWLLGLFNKLASGYFALSRYKCADAISSFNSLSQGQRETPWV
FT                   LSQLGRTYFEQASYTEAAKYFSRVQKLAPSRIEDMEIYSTVLWHLKSDVELAYLAHQLL
FT                   EADRLSPQAWCAIGNSFSHQRDHDQALKCFKRATMLDPGFAYAFTLQGHEYVANEEYDK
FT                   ALEAYRHGINADNRHYNAWYGLGTVYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLV
FT                   LEKMNNPQDALVHYGRASSLAPHSVLAKFRKARVLMKLREYKFALAELKVLKDMAPDEA
FT                   NVHYLLGKLYKMLHDKANAIKHFTAALNLDPKAAQYIKDAMESLDDDDMEDEDIA"
FT   CDS_pept        join(962832..963543,963604..963770)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000026375" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950892"
FT                   /orf_name="Pc13g04040"
FT                   /product="Pc13g04040 protein"
FT                   /function="1-acylglycerol-3-phosphate O-acyltransferase
FT                   activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91473.1"
FT                   /db_xref="GO:0003841"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniParc:UPI0001830916"
FT                   /db_xref="UniProtKB/TrEMBL:B6H266"
FT                   /transl_table=1
FT                   /translation="MSFGSYIVSGVSSFVVLTVSLFAIGQKVPRAAFAARCLASYGSLL
FT                   VSAAYGVIVSVCLRLVGYGRISQWAAGRSFKWMMRLTTGVTFEVVEGAEYLSTRPAVFI
FT                   GNHQTELDVLMLGCVFPPYCSVTAKKSLRNVPFLGWFMSLSRTVFIDRANRETALKAFD
FT                   GAAAEMRDHRQSVFIFAEGTRSYSDEPTLLPFKKGAFHLAVKAGVPIVPIVTENYSHVL
FT                   SPRAWRFNAGTIKIRVLPPIPTKDLTSGDVDSLTQSTRDSMLKTLAAMSHAHKNEVDGA
FT                   RANGVSSAIEI"
FT   sig_peptide     962832..962906
FT                   /db_xref="UniProtKB/TrEMBL:B6H266 "
FT   mat_peptide     join(962907..963543,963604..963767)
FT                   /db_xref="UniProtKB/TrEMBL:B6H266 "
FT   CDS_pept        join(complement(965816..965905),complement(964559..965737))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129527"
FT                   /orf_name="Pc13g04050"
FT                   /product="Pc13g04050 protein"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="CAP91474.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI0001830917"
FT                   /db_xref="UniProtKB/TrEMBL:B6H267"
FT                   /transl_table=1
FT                   /translation="MASIQVWMLRIQGANIRDHNAMVDPSVSGINDIPKDQPTLVRWYM
FT                   DVRRWDEKYFDLPLLETLTQPDQAAVKKYYQTSDKRLSLASQLLKYYYIHQATGTPWSK
FT                   IEIQRTPMPENRPFYDSSLDFNVSHQAGLTLFAGTRAATAHSLSGGPQTLPRVGIDVAC
FT                   VDEPSRRRANRPPKTLADLATFVDVFSDVLSLRELATIKNPYATLKLARELGLNKSDPS
FT                   KDDQEVLAAYGIRLFYSIWALKEAYLKMTGDGLLASWIKDLEFTNVVPPEPVQTVGFAG
FT                   DPSATHAPSVQNWGRPYSDVKISLRGIPDHSVRVQLVGFESDYIVATAASGPNIGSVSR
FT                   QVVVNDSDHHLPGRITAFDSETGLQNVRIPPIALRSIGDGDPWRVDSKISDPWLPMQEV
FT                   DIEIDIRPCADGRCEHLRDLPSF"
FT   CDS_pept        join(966426..966658,966713..967283)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950893"
FT                   /orf_name="Pc13g04060"
FT                   /product="Pc13g04060 protein"
FT                   /function="transferase activity"
FT                   /biological_process="glutamine catabolic process "
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="CAP91475.1"
FT                   /db_xref="GO:0006543"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="UniParc:UPI0001830918"
FT                   /db_xref="UniProtKB/TrEMBL:B6H268"
FT                   /transl_table=1
FT                   /translation="MAITVGVLALQGAFFEHVQLLKKAAEQAQPSEWHFIEVRTPQELA
FT                   TCDGLVLPGGESTTMSLVAARSNLLEPLREFVKVDRKPTWGTCAGLILLAESANKTKKG
FT                   GQELIGGLDVRVNRNHFGRQTESFQGPLDLPFLGQDAPPFPAVFIRAPIVEKILPHHEG
FT                   IQAEEIQQEDVVVAPSREARDSVAQAATAEHVEVLATLVGPAAQHATEGRDVNPDQEVG
FT                   DIVAVRQGNVFGTSFHPELTGDARIHAWWLREVQAAVLRREKLKQ"
FT   sig_peptide     966426..966470
FT                   /db_xref="UniProtKB/TrEMBL:B6H268 "
FT   mat_peptide     join(966471..966658,966713..967280)
FT                   /db_xref="UniProtKB/TrEMBL:B6H268 "
FT   CDS_pept        join(complement(968162..968227),complement(967968..968071),
FT                   complement(967866..967910),complement(967622..967813),
FT                   complement(967435..967564))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825162"
FT                   /orf_name="Pc13g04070"
FT                   /product="Pc13g04070 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP91476.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001830919"
FT                   /db_xref="UniProtKB/TrEMBL:B6H259"
FT                   /transl_table=1
FT                   /translation="MSLLARNTVDRLDRPSAYYVSKNKRRRFNDRDEDEPQQEEKPDEK
FT                   LKNATTLYVGNLSFYTTEEQIHELFAKCGEIKRLVMGLDRFNKTPCGFCFVEYYTHQDA
FT                   LDCLKYIGGTKLDERIIRTDLDPGFEEGRQFGRGKSGGQVRDEYREEYDPGRGGYGRAY
FT                   DEQRQREEDEYGAGR"
FT   CDS_pept        join(968476..968784,968856..970967,971024..971187,
FT                   971242..971299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129528"
FT                   /orf_name="Pc13g04080"
FT                   /product="Pc13g04080 protein"
FT                   /protein_id="CAP91477.1"
FT                   /db_xref="UniParc:UPI000183091A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H260"
FT                   /transl_table=1
FT                   /translation="MVKVNSYAPAWLCRPSPGAKFLSSSSAQNPAEDLQTGRKPVSSGA
FT                   TRTIAKRGNEVFAVVDNEIRWSNLARLKDQWQQEIKQKKGSVSETEEQTDNTQISPYRV
FT                   LAVPVYGLIKQIIPSPNGAFLAIVTEHTVHISVLPDSSHLSSSDSDSIRLKTYQLGPTT
FT                   HVIPEAPVVSALWHPLGLHTNLGGCIVTITADAAVRVWELDRNNHWSFDQPTLAIDLKK
FT                   LVDGTSSDQDFTPSGFGKSKGFSADVIDMEVASACFAGSGNEKEDAWAPMTLWVAMRPG
FT                   DLYALCPLLPSKWQAPSTTIPSLSAAIIPKLGALEQEPEESEEELIACRQQYDWLSELD
FT                   EQEPLDTPSGSETIQGADVFTRPANPSAIPRLQGPFRFDSGDELDDLDLCDLLVIAASL
FT                   NVEDLMMGEEEELAVETGDQEKLSATVLSLTSGNGRVHVCLELDGVEGQWLPKAKKNAF
FT                   RTPISEPTELVLVESLDTIKDGEETTTWPTFTKDVHSRYSFFVTTATNVVFLSLSGWVQ
FT                   RLEAELQTEDTAGSAFRLRVLCDGDVTNRQRILQVSDADTTAQNEHLAASLVFHDFDLG
FT                   YLLLTYHPSNPYAVVMDAPEDSLSVALDKSLYEPRAPAPGLPVLPPSRAPYQVPAIFYA
FT                   NSPLDSFVEKHVPHRQRHTLKEQVRLSPATLDLVATAHRVLSAHTNALERAASDLFRRC
FT                   ERLQGEMQDQLKQLADVAERVKGVTSEIGEDGHRKEGVRNGEALDKRLQAAQDKQSELN
FT                   RRYEALRTKVLNSGGRPLSEREKAWITEVKTLSASLQQVEEQEEEQPLVSRLETVKRLA
FT                   RDLMAQTKSVAGKMPSPELGTPSSPGGQPKVPQRLQRAKVADAMRMVERESAVIEAITS
FT                   RLERLNTSL"
FT   CDS_pept        join(complement(971696..972393),complement(971500..971557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950894"
FT                   /orf_name="Pc13g04090"
FT                   /product="Putative uncharacterized protein Pc13g04090 "
FT                   /protein_id="CAP91478.1"
FT                   /db_xref="UniParc:UPI000183091B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H261"
FT                   /transl_table=1
FT                   /translation="MCIYWTCKYTLCGCIWDMDPSKCQDKRLCWGPRMITLESHTATCA
FT                   DCWARGDKRVYEPPTCEKTDRDEEDPEMATLDFEPNAAESDNISDDDEEYFSAEESLSP
FT                   SPCSRPATPQLYYEVHPPWCPVSEDNDFDLTRACDPVDLTSVGRDYRARRHKTTTLEYL
FT                   SDSEDSFVSCEEYVDEETPDEESFSSGNEEEDLYYSIIGPPGRPKGLIKSLEDRSLLFY
FT                   GSAQEYYPTGEWEQDEAPKWCGFMKRAAI"
FT   CDS_pept        join(complement(975283..975285),complement(974833..975233),
FT                   complement(974659..974779))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950895"
FT                   /orf_name="Pc13g04100"
FT                   /product="Pc13g04100 protein"
FT                   /function="isomerase activity"
FT                   /protein_id="CAP91479.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000183091C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H262"
FT                   /transl_table=1
FT                   /translation="MADTGLPAGWEVRHSNSKNLPYYFNPSTKESRWEPPAETDTDKLK
FT                   VYMAQNHTPAARPDPSGEGEGKIRCSHLLVKHRDSRRPSSWREADITRTKEEAIEILKG
FT                   HEQRIQSGETTLGDLAVAESDCSSARKKGDLGFFGRGEMQKEFEDAAFGLQPGQVSSVI
FT                   ETASGVHLIER"
FT   CDS_pept        join(975675..975754,975810..975981,976181..976270,
FT                   976350..976394)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825163"
FT                   /orf_name="Pc13g04110"
FT                   /product="Pc13g04110 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91480.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI000183091D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H263"
FT                   /transl_table=1
FT                   /translation="MSASPSSTAGGDTKPSDQIHFKFCRECSNLLYPKEDRVNNQLMFT
FT                   CRTCHVGEPASSHCVYQNHLHSQVGDTAGVTQDVTSDPTLPRANKLCPSCGETEAVFFQ
FT                   SQQRSAETGMKLYYVCCACGQVYV"
FT   CDS_pept        join(complement(977216..977230),complement(977076..977163),
FT                   complement(976765..976989),complement(976634..976704))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129529"
FT                   /orf_name="Pc13g04120"
FT                   /product="Pc13g04120 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP91481.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI000183091E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H264"
FT                   /transl_table=1
FT                   /translation="MIQLKQTLLNCIDNSGASIVECVNVLKKKRPATIGDRIVVVVQKQ
FT                   RSAGSEATTAAALASKVRRGDIRHAVVVRVKKELQRPDGSLVRFGDNACVLVNKSGDPI
FT                   GTRMNGVVGQELRNKKWSKILSLAPIHV"
FT   CDS_pept        join(978491..978604,978665..979665,979765..980584)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672470"
FT                   /orf_name="Pc13g04130"
FT                   /product="Pc13g04130 protein"
FT                   /protein_id="CAP91482.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI00018309F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H269"
FT                   /transl_table=1
FT                   /translation="MPPKRARKSSPAAERRERLTLAKLASYDDVATDALVDHAYFWTTT
FT                   RKNRTKYSPARGIHDDDVGRILLEDVIVDKDIPKAERKLLELPGLKKYMTNLRSPREKE
FT                   WFRRHLRKYIQMYLPDCPFEVTTTNRYIITQHEAAICARRFIKKGEEIKHLSGTLVSMT
FT                   HEEELDLGLTRKDFSIVMSSRRRAPSFFLGPARFANHDCDANGSLTTRGNEGMSVLAMR
FT                   DIHEGEEITVSYGEDYFGIDNCECLCHTCEIAVRNGWSSHVDTETNSKESSPASEVTAT
FT                   EDTPAENSNVSRKRRRSSDMEEPDSSSTLSCSTPRKRAKFQRQVSKLREEISVSELTGE
FT                   SGSAPPRGSDSTPIQDTVLISNALLAETAPQVVARRGDLNGTNGTNSTIPTDCESLSST
FT                   ADQSHRSSTSTTPTTEDDIEPQIKTEDTTLQPSESKALNGKDHPDASPEGQHITTHPMD
FT                   IDPEEGLSDLSNSTKLDDDKVVDKPKKRKPRTKRRFIVDSVETESQVARFPGDYTKTPR
FT                   LLAQKYDRWVECQTCDTWFLQSNSYLTRRECPRCERHSKLYGFQWPSTDKGPDGEERVM
FT                   DHRTIHRFLSPDAQSRICRRDRGVSFGITPTPELSDTNTPETETSDVTESRRDARATRR
FT                   RTRELRMTM"
FT   CDS_pept        join(981244..982599,982682..982893,982962..983022)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950896"
FT                   /orf_name="Pc13g04140"
FT                   /product="Pc13g04140 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91483.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00018309F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H270"
FT                   /transl_table=1
FT                   /translation="MRFSNLIATLLLGFGVTGSTAWDNPLVSLDYGSFQGQYDSTYNLS
FT                   YFRKIPFAAPPTGENRFRAPQPPLEVTEDVYDTNQDFDMCPQRTVNGTEDCLYLGLFSR
FT                   PWDLAKDTSRPVLVVFYGGAFVQGSAAFAMPPSSFPVLNVSNINDYIVIYSNYRVNAFG
FT                   FLPGKAIKDSHTSDLNPGLLDQQYVLKWVQKHIHRFGGNPHNVTIWGQSAGAGSVVAQV
FT                   LANGRHGQPKLFSKALASSPFWPKTYKYNAPEAEEIYSQLANLTGCASRHADKTLACLK
FT                   SVDVQKIRDASLIIGASNTWTTSSYTWAPVIDGTFLVETLTDTVNRRSLNTEFVWGMYN
FT                   SHEGENFVPSGLDSPVLENGFDSSLASFHQWLSGFVPGLSGKQIDEVETLYPAEGSTET
FT                   IDSYKSSYVRAGLVYRDVVLACPAYWIASAATERGHLGEYTISPAKHASDTIYWNKINA
FT                   VQETNPVVYKGYAGAFASFFQTGDPNAHKVTNASQPGVPELRTGEEFVVVEDRLENVKL
FT                   VQLKKRYFDSIGLGRRYTRKLVRYI"
FT   sig_peptide     981244..981306
FT                   /db_xref="UniProtKB/TrEMBL:B6H270 "
FT   mat_peptide     join(981307..982599,982682..982893,982962..983019)
FT                   /db_xref="UniProtKB/TrEMBL:B6H270 "
FT   CDS_pept        complement(983205..985109)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978330"
FT                   /orf_name="Pc13g04150"
FT                   /product="Pc13g04150 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91484.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018309F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H248"
FT                   /transl_table=1
FT                   /translation="MPLPIRSSICFLCQTKATLIAPSILPTSWQTTRGMATVRLRRKAA
FT                   RMALSPTVSKPSLPSPNKPRRERPGPFASMNQTQARIRDTPRTRSQAALKRSGEEGKTE
FT                   KKESPLYKALKMQTTLTPVPYGRRSAIKARLADITSFDHFPLLPAVRQSIFAQALAGLT
FT                   DVTPTPIQRLAIPELLLDESKKKKKVKKANEDEEEYDFDQYLLAAETGSGKTLAYLLPI
FT                   VDAVKRAEVIDMQEEKALEEQKAREREERMKNKAFDLEPEEPPMTNAARPRAIILVPTS
FT                   ELVSQVGSQLKELAHTVKYRSGEISSTFTPRRIKNTLFHPAGIDILVSTPHLLGSVART
FT                   NPNILSRVTHLVLDEADSLMDRSFIPTTSEIIAKVAPSLKKLILCSATIPRSLDNQLRK
FT                   RFPDMQRLTTPNLHAIPRRVQLGVVDIEKEPYRGNRNLACADVIWSIGKAGDRHEHTET
FT                   WGPLNAYMEPKVKKIIVFVNEREEADEVARFLQSKGIDAVSLSRDTDSRKQQETLSQFT
FT                   EVKLPPTAEEIMINKKKNRAAGSIPFEFPERQEPIRRLPDTKVLVTTDIASRGIDTLAV
FT                   KTVVLYHVPHTTIDFIHRLGRLGRMGKRGRGVVLVGKKDRKDVVREVREGMFRGQALI"
FT   CDS_pept        join(986834..986923,986975..989744,989799..990496,
FT                   990551..991174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950897"
FT                   /orf_name="Pc13g04160"
FT                   /product="Pc13g04160 protein"
FT                   /protein_id="CAP91485.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI00018309F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H249"
FT                   /transl_table=1
FT                   /translation="MGNGSGQRPLSEVSPMAQRRNSPSWNQVTKMPHGESPAYDVSSLN
FT                   NNNSPRLFWKGRDSPSPFPKGAENKAPYDPEGCYFPTKRPSLENLKRVSKVKNHSMFLE
FT                   GGQEYDPASVVFPHRPLASERSPQRDSQMNVAKSQFDEDTTQISRPSSPSKDQASPSKS
FT                   SLSKGSRYGKGFDPQNDIWSEYGSAGHRHAKSVTFDHAPPQVNEYEMTTPDLSSVASES
FT                   RENSYESDEEGDLSFEAESSIERDDSFDASLEDIEKTPVVLPEDWRFMSPSTNSDGDPF
FT                   VEDVEEDSTEGRPISREGGSSQHTRVESLDSNGERRPLPPLPSVNRTSGARPSSAGKLA
FT                   AAFELGSAGQRVLPSPPAAASYTKSDIPGAGSIEERLRLMMLQERDDDYEKYDDHAKNI
FT                   EEPLELPRADESLTSKDDTHKDDEAKENFFSPPRISRDSILRGIRKGDSYEDDSFDDSS
FT                   QIASSPNRYDHYDPDVPIPSMETDDDDSSSVIIKQEENDEDLYSITDYYQNRSDNSLSS
FT                   RDQRAKYDEDSNYSLRSAAEAAERKHAGYDGHKEGSGETTPNAESQADAQKSAPLNEDA
FT                   KACKEPNAPQDQSFDMASIRQSLARPLTPEMPQDQASEPSTPDSVIRHPIEDDHEEDDN
FT                   KEEEGEVEEEEEPELAHDESSSDESVPEPVATIRAPGAGLKTRPSLTPADMQSMAATRR
FT                   QISGQHAPPVPSLTKQISNDSNSSDREHKQTDSPPKLGLPTDLAQRQSSCLKLDIPFSI
FT                   QEESLGFGLDKEFDRVIESQKVAFHLALSQSPGSVPPSQAIAPNDCATPGNSAHPADSP
FT                   TPKQRGYLMRQNTKVIIASSRNEDEEALPSPERTAQDPRGTRSAGSSPRKPSQQTWTTV
FT                   PWNGSPRRPSIKPGNGVPKKKPVPGAGGVPPLPGQPSNVQEAPSTIGENEPAISESFED
FT                   GEERGRLFVKVVGLKYCDLPLPRGERSYFALTLDNGLHCVTTSWLEMGKSAPIGQEFEL
FT                   IVQNDLEFQLTLQMKIDESKFQTQEPAASPSRQKASALSRVFASPRRRKELDIKQQMQS
FT                   QQQKTKDVNAPVYERLRNLVARDGSFGRAYVALSDHEEQAFGRPHVVDVACFNEWAVEE
FT                   QMSSIKSKKSATSINTQRRPPYKIGKLEVQLLFVPKPKGSKDEDMPKSMNACIREMRDA
FT                   ESVASRSWEGFLSQQGGDCPYWRRRFFKLQGSKLTAFHETTRQPRATINLAKASKLIDD
FT                   RSSLLQKETSTKGGSRRKSAFAEEEDGYMFVEEGFRIRFGNGEVIDFYADSPADKEGWL
FT                   RVMSEAVGKGASSGNGALKPWADLVLKRERSMKTSNETAPRRPTSGIPTPAPPQSPVRS
FT                   RNSAMMGPPSSAGSGAPAPQSPRPRHKHTHSQPEIGSVEARRQKTRSLMF"
FT   CDS_pept        join(complement(992602..992767),complement(991673..992502))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129530"
FT                   /orf_name="Pc13g04170"
FT                   /product="Pc13g04170 protein"
FT                   /protein_id="CAP91486.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR015916"
FT                   /db_xref="UniParc:UPI00018309F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H250"
FT                   /transl_table=1
FT                   /translation="MAAIQAKWTKVVEAEILQRSSQIVSAIDKQIYIFGGELRPREPRD
FT                   NDVHIVSLGTPATLSAKPSTDQSPSPRVGTASATLNGKIYLFSGRGGTAMAPIEESGAM
FT                   WEFDPSAEKWSLLAPQTNPTVPAARSYHCTASDGKDTVFIHAGCPENGRLSDLWGFSVS
FT                   QKTWTELAPAPDPPRGGTSIAFAGDRLYRMNGFDGKHEQGGRVDVYEPGANVWSSHEFV
FT                   ADGVAGPSPRSVAALLPVVVSGRVHLVTMFGERDPSSLGHQGAGKMLGDVWAFDVETKL
FT                   WTKVEAQGDESPAPRGWFDADVLDAGSVVVHGGLGESNDRLGDLWTLQFF"
FT   CDS_pept        993806..994750
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672471"
FT                   /orf_name="Pc13g04180"
FT                   /product="Pc13g04180 protein"
FT                   /protein_id="CAP91487.1"
FT                   /db_xref="UniParc:UPI00018309F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H251"
FT                   /transl_table=1
FT                   /translation="MASAAVQLPASHGYLLSEKPGVPVSEKPHHVQTTLNFFKENEDGS
FT                   PPAPTYTSRPETYDRPAVSLAATIHDISGHELDYKLDTHGFQLYYHESQEKDFLDDEKI
FT                   KREYYAETEQLLKDAYATPKPISSHKTNIDLRSTGASRIFIFDHTIRRAPTDGSVGVRL
FT                   RGPVQRVHIDQSYTASKNRVSHHLPDEAAELLKGRYQIINVWRPIKTILKDPLAVADAH
FT                   SVPDSDLVPIGLIYPDREGETYGVKPDPNIKWYYRYGQTPDLVTLIKCFDSKVDGRARR
FT                   VPHTAFVNPETENEAGRESIEVRALVFHPDDRD"
FT   CDS_pept        complement(995125..996000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825164"
FT                   /orf_name="Pc13g04190"
FT                   /product="Pc13g04190 protein"
FT                   /protein_id="CAP91488.1"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI00018309F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H245"
FT                   /transl_table=1
FT                   /translation="MAPQPIPFPGFTPISDRVYLRNGHEKSKPAPADEPTTIIISGWGD
FT                   GMPKHVTKYSDGYHELYPSARIIVILSRTFQATNQPEEVRIQAMMPVVDTVFPTPTGSG
FT                   NEKERVLVHAMSNTGAIFTASTVIAYQRRHGADKPFPHQLLVLDSTPGSLDFRSQATRW
FT                   SRAMAVGTAKFFPWPFVITHGLWYAFLWANYLWQVLRGAVSSGVWADRIINDKACVATD
FT                   SSRVYLYSKEDEIIGYKDLEENVAHTKTLGYSVDLEMFEGSSHVGHMRLHPEQYWNKIS
FT                   SSWKQAIAEK"
FT   CDS_pept        join(997568..997755,997854..997965,998016..998728,
FT                   998777..1000166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950898"
FT                   /orf_name="Pc13g04200"
FT                   /product="Pc13g04200 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91489.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018309FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H246"
FT                   /transl_table=1
FT                   /translation="MKVAIPRQRFIVAPPSNKRVSRACETCRQRKIKCNGKTPTCRQCE
FT                   ETNSSCVYPLKSRERTTRQIESFHQQVQDYESMLKDIGNLVDGQSAKRIKDLLQKYNAD
FT                   SDDGSNSTPDVSHDRNGSKRSPSPSSVGSLEAVDRVEEDLNLTESSRATGYMGKSSEIT
FT                   WMGRVQEGTEQRSRGQSPKAASEDHTNDKVAPSAVNYHIDDIGVDAPGPVQMYWVPPRQ
FT                   VADHLFETYLRAVHPHFPIINSTLFSTQYRDFFDDRSYPGDKWLAILNMIFAIAAEYLY
FT                   NSDGTQRGDIKDHLFYLTRARMLSMGGDSLFEHPDLQQVQIEGLIAFHMLSTNQVNRAW
FT                   KISALAIRSATSLGINLKSSCHKMLGVSKEIGCRIWWCLYTVEHTLGSMTGRATSISTN
FT                   MYTTQLPLPFDEDHLPEPTATMLLGDLDERAKRVDMAMTSPYIRHPDLQPSEDTPAARS
FT                   WLQSLPVNPSLYFLYYCDLAVVNQEILDHVYSPESATISWEDIKSRTSRLRTTVDAWVS
FT                   SLPPGLDFASVKDENQQSYWAKTNLAFHYYNTRIMLGRPSLCRHSRADRGRKSVEQRGF
FT                   SHDMAVMTLESAMHMLDLLPNKPSMRHIYRFCPWWCFLHYIMKTATVIILELSFHCVHA
FT                   PDRESDLVESAKKSVRWLHMMSINCIASHRAWQLCESAVRRLVSSMGYDDSDIPPPPKR
FT                   QRGDQFGDNGAVPPGQHNGTAGGGQVLPYNGQGQSSVLPHESHAMDHSNNNPDLTGSLA
FT                   FGFLATPSSQDHTDGYFPYDPISEEFLRYFFPALDGEANPSGERNTF"
FT   CDS_pept        join(complement(1000982..1001061),
FT                   complement(1000308..1000869))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950899"
FT                   /orf_name="Pc13g04210"
FT                   /product="Pc13g04210 protein"
FT                   /protein_id="CAP91490.1"
FT                   /db_xref="UniParc:UPI00018309FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H247"
FT                   /transl_table=1
FT                   /translation="MSPTYKKMFEARQTFKPVRRYGQPDGRKPSREKSEYWKNSQRTTE
FT                   NDEDEERLRLCYEELETVKRNHSQNEQKMFADESMIPPGPLKRDYDAMRQDPTWYLRKE
FT                   LIEDCFGRGCCCARGCDCCRNRASAYYKRGVGHCTTDCGCCASERGFEYTAGEKQQIVE
FT                   QFDKMLRSRNPSYIVKMAEAYFVKPLEQKVLEQVQKKKVQKKRVWWKQLL"
FT   CDS_pept        join(complement(1002903..1003218),
FT                   complement(1002354..1002486),complement(1002209..1002302),
FT                   complement(1002094..1002153),complement(1001794..1002030),
FT                   complement(1001425..1001724))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129531"
FT                   /orf_name="Pc13g04220"
FT                   /product="Pc13g04220 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91491.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H271"
FT                   /transl_table=1
FT                   /translation="MRLGRTFTTFLSWALVASATILENGQVRENSYPGQLEPVTLDDSW
FT                   RDYPADAPEISYKGRWDSQHISCMFPIRFLFPRLLFLTLTLTLERTSGWSYVLQLSPIL
FT                   SLSPCRSTCSSLTIHTVQIAGVAVAKDAVLTKPPTFEKRVEIIGGSLASGQFATYETIS
FT                   SWSFLFANGLGNVEYGITAYPGVCLADEQCYGGSSRGVGWYWHRASDPGSRARAMYDHS
FT                   PEKWDVKAEQPADLVIIQMGGNDHRHPNEIPGRDYYHAYVELVEDIHSNWPNAIILLMS
FT                   QWGTFSKEGKKYVGSTYYQEETRQVNEHFKDRGFVYYFPTEGLLQHNDINPKNHLTDVG
FT                   HIKVASHLLQWVKLVLRWNLEPTGEVQSGTTYWNDQQEY"
FT   mat_peptide     join(complement(1002903..1003161),
FT                   complement(1002354..1002486),complement(1002209..1002302),
FT                   complement(1002094..1002153),complement(1001794..1002030),
FT                   complement(1001428..1001724))
FT                   /db_xref="UniProtKB/TrEMBL:B6H271 "
FT   sig_peptide     complement(1003162..1003218)
FT                   /db_xref="UniProtKB/TrEMBL:B6H271 "
FT   CDS_pept        join(1005634..1005747,1005799..1006426,1006481..1007184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950900"
FT                   /orf_name="Pc13g04230"
FT                   /product="Pc13g04230 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP91492.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniParc:UPI00018309FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H272"
FT                   /transl_table=1
FT                   /translation="MEYIQPNHLYSRILDNIPWKSADPSVKGDPRKSVKWIDGLRGIAS
FT                   FLVILTHLARAWDYDLFAPRDDVDKPPRILQWPVFRIPWQGRLGVTIFAFLTGYVCALK
FT                   PLKQSRNGDILGSFTSVGKSAFRRPPRLIFPATIALIISWVMAQCGAFIAANRSDCWWC
FT                   RYAAVDLAPTFWEEFVRLFKTFLEVWTTGYMAYDDHQWALLPLLQASMLIYILVCATMF
FT                   CKFRFRVAIYLGMYLYFHQNAAKNTETFQMQAIYGMFLSDLSYEKGFKEFVERHSWGRK
FT                   IVAGILLCLGLFICSYPGEHPEWATWSSYMEQASHYIFPPKVNVGKRYSALGVDLIIFA
FT                   IYISPSTKEFLSSSLLLWLGKQSFAVYLVHGTLLRTVLCWMLYGITGQPWEGDIVDEKG
FT                   NPIYGEDGEPLHPHWIPIRAPWVVAISIPSWIVLVYFCATLWTGYVDPFCARMAQKLEK
FT                   WMFEEDEQAPPPLPMTSIPMQTA"
FT   CDS_pept        join(1007962..1008250,1008332..1008471,1008576..1008636,
FT                   1008882..1009029,1009221..1009332,1009386..1009448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950901"
FT                   /orf_name="Pc13g04240"
FT                   /product="Putative uncharacterized protein Pc13g04240 "
FT                   /protein_id="CAP91493.1"
FT                   /db_xref="UniParc:UPI00018309FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H273"
FT                   /transl_table=1
FT                   /translation="MNEGRCVASFAVISANPRIVLTPVTAIVDFLSVHDVQCTMWVIAV
FT                   RKPRYDGNVFLFLFGFCSTARSKINSRARELSFLVSASTAPVCSASGPRTSAPIQRVYF
FT                   RRKFVAVYRFGLGKNRPCSPGGEVGIQWGWMIISPYRTSLRGFCSHGLEVFVSTITLSA
FT                   WYGSAKLCVVSVEDGCAILAMFPNIVLEACRSSLHFHDLSMMAEGCPYAGVALSSFAFP
FT                   NGGYPWATGTSRHRGLMTPEVAILMLNEQIEGVCAGYPFPARRLSSQI"
FT   CDS_pept        join(complement(1010944..1010967),
FT                   complement(1010611..1010718),complement(1010487..1010547),
FT                   complement(1010197..1010381))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825165"
FT                   /orf_name="Pc13g04250"
FT                   /product="Putative uncharacterized protein Pc13g04250 "
FT                   /protein_id="CAP91494.1"
FT                   /db_xref="UniParc:UPI00018309FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H274"
FT                   /transl_table=1
FT                   /translation="MADDSQHPLWCKHCEVEGHLVIHCHALYEELTNFDAAFKMAQGQA
FT                   SDPKNAYPVARWGQAKKKKDVSVPGINCPSNPFAHLSPWEADTLANYPEQQWAYWMQWE
FT                   ADALASYLDQKWTYFLQWHAA"
FT   CDS_pept        join(complement(1016455..1016788),
FT                   complement(1016062..1016396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129532"
FT                   /orf_name="Pc13g04260"
FT                   /product="Pc13g04260 protein"
FT                   /protein_id="CAP91495.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI0001830ACF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H281"
FT                   /transl_table=1
FT                   /translation="MTEPSQPPVPEEPPNAVLNDSRPTSARDSRDDDREALELHTIQTR
FT                   EDDELDYSTASASSGEEHRVPTNRITSRPDSQRRLEARKGLWGKICRLWTRNVVITVPQ
FT                   KSNRDHFALERTFLAYIRTSTVIAMQGVLVAQLFRLQRPPEKANRHRLTFYELGIPLSV
FT                   ACHIVAVIVALIGAVRFFRQQNAIVRGKVHAGGWELYSVGFLLFLVSSFSLGRCWISGF
FT                   "
FT   CDS_pept        1018213..1020765
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000251716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129533"
FT                   /orf_name="Pc13g04270"
FT                   /product="Pc13g04270 protein"
FT                   /function="aminomethyltransferase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91496.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI0001830AD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H282"
FT                   /transl_table=1
FT                   /translation="MSLSQRVVIIGAGIVGTNLADELVSRGWSDITVVEQGPLHMPGGS
FT                   TSHAPGLVFQTSPSKTMTHLARYTVEKLLSIEKDGHKCFNQVGGLEVATTPARLEDLKR
FT                   KHGYASSWGIEARLVSAEECYKMYPHLNNEMVLGGLHIPSDGLALAARATQLLIERTSK
FT                   AGVRYLGHTPVTGIERDGRRVTGVSTPSGTIPADIVVSCAGFWGVELGAMVGVEIPLLP
FT                   LAHQYAKTTAVPALAGRGINNMINGMNATLPILRHQDKRLYYREHGGQYGIGYYGHRPM
FT                   PVVAASLGLTPKEVDEKNMPSRLEFTTEDFDPAWKESQKLLPALQNTEIADGFNGVFSF
FT                   TPDGGPILGQPSHLDGFYVAEAVWVTHSAGVARALAQILTTGRSDIDVSECELSRFEEV
FT                   QLNRDYVSETGQQNFVEIYDIIHPLQQRESPRNLRVSPFYAREVELGAVFFETGGWERP
FT                   WWYEANKDLVKSLPPSWQPVERDSWSAQLHSPISAAEAWKTRNAVAMFDMTAFHRFDVR
FT                   GPGAVGLLQRLTTSDITTKPGTVTYTLLLNDHGGIRGDIFVLRLDDDVFQIGANTATDL
FT                   AYLTREARVHEQNTPGQWTEVRDVTGSTCCIGLWGPRARDVIAGITTVDVSNKGLPYFS
FT                   LKKTVIQGIPVTLIRKSYVGELGWEVQTSAEYGQRLWDTIWQAGKLHGLIAGGRSAFNS
FT                   MRLEKGYRTYGVDMTTEHNPFEAGVSYAVDANKKDDFVGKAALQRLSKQVPSRRLRALT
FT                   VDDGRSMILGKEPVFHNGKAAGYVTTAAFGYTIGKPIAYAWLPGYLREGETVEIEYFGK
FT                   RIRATVEAESLYDPEMNRLRQDSLPSATGPETAFMSRL"
FT   sig_peptide     1018213..1018272
FT                   /db_xref="UniProtKB/TrEMBL:B6H282 "
FT   mat_peptide     1018273..1020762
FT                   /db_xref="UniProtKB/TrEMBL:B6H282 "
FT   CDS_pept        join(complement(1022513..1022743),
FT                   complement(1022111..1022405),complement(1021054..1022057))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950902"
FT                   /orf_name="Pc13g04280"
FT                   /product="Putative uncharacterized protein Pc13g04280 "
FT                   /protein_id="CAP91497.1"
FT                   /db_xref="UniParc:UPI0001830AD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H283"
FT                   /transl_table=1
FT                   /translation="MVTSSIFPLEIWLMIFQYLRDEESPQHISRLAQTCKSFHQELNHL
FT                   LYHPVRLRRVENARHFANTISSRPDLAALVKENLPPSDDGHTPQAEVQAVFTDIYYQNQ
FT                   DFHMRDCEDDLLALMMWMDDKGYPLGDASDPFGLGFNPLGHFSFQSWAEDLSEYTYFGQ
FT                   NYLKDLIPALQTCHIGTDSDLDPIHNAGKYQPYVEFNETIFTLPHLRKLCITGVTFRDF
FT                   GLKDELIEHRTTNLKELLLLNCGISTENLELIIRFPRALERLTIRVPVSLLSEYEEEDY
FT                   LSFSGELSARHAESLEYLDLDIYGGLDVGFGLDYFDVLKEIVITPHSVIKDHDGETVLT
FT                   SSLQRLTIRYEEGTGLLLDDIFNQVETAKLPNLRSVICQIPDNLCEGTTSSAVRVEAEA
FT                   FKSLFKDLGVELSTELVPYPLTMPKYDVCPCENLTFYHQFPFHPRPKPRPQNVPASYSN
FT                   PMPMPVVHDSDPYDGDYPYLYDMSPPSPPRMPTSMPTFMDYDDYLDWMYGG"
FT   CDS_pept        join(1023443..1023682,1023757..1023840,1023896..1024036,
FT                   1024088..1024192,1024256..1024675,1024733..1024790,
FT                   1024844..1025125,1025181..1025240,1025302..1025678)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825166"
FT                   /orf_name="Pc13g04290"
FT                   /product="Pc13g04290 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91498.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830AD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H284"
FT                   /transl_table=1
FT                   /translation="MSLVNEVNVDRVSGDSKNPRNEAVPLGEPVSLMGQGSPGVRRIEI
FT                   ITSYFRFWDRVFLFLAVFLIAYVYGLDGTVRYTYQPYATQFYGQHSLLATINVLRAVIA
FT                   AAAQPTAAKVADVFGRVELILVSILFYTVGTIVESCALTLSGFAAGAVIYQIGYTSIML
FT                   LVEVLVADVTSSRSRLLFSYVPAMPFIINTWISGNLTSAVLKTTTWQWGIGMFAIIYPV
FT                   CAIPLIVVLFIVHRRAKKSGALESYKSSLQLLGKRQLALELFWHLDIVGNILLIAMLAC
FT                   ILVPFTLAGGVTAQWKTAKVIAPLVIGVLLIPVWIFWERTCQHPMLPFKLLKDRAVWGA
FT                   LGIPIMLNTAWYLQGDFLYTVLYVSFGESVLSATRITQLYSFVSVITGVILGLIVMKVR
FT                   QLKPFIVAGTLLFMVAFGILIYFRGGVADSSHSGVIGAQVLLGIAGGMFPYPAQASIQV
FT                   ASKHEHLAVITGLYLAAYNVGSALGNTISGAIWNQVLPSELNYRLGNETLAAYVYAKPL
FT                   EFAAVNPVGTPDRDNVILAYQKTQRLLCITGICLTVPLIAFALVIRNPTLTKEQSLAKA
FT                   EEESSDSDFSPR"
FT   CDS_pept        1026552..1027613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950903"
FT                   /orf_name="Pc13g04300"
FT                   /product="Pc13g04300 protein"
FT                   /protein_id="CAP91499.1"
FT                   /db_xref="UniParc:UPI0001830AD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H285"
FT                   /transl_table=1
FT                   /translation="MAATSTPGNNEPHRILLVSVPRTASNLLLKVLNIPNQPNVLSSPK
FT                   GGYFFYDAFMAAGIEGLVEKPLDQWTAEEKSETKAVVQKCFDRLEEYSARARAENKIMF
FT                   TKEHAFWLVNPCFFTNNEGITPEDHSQFQVSMPERYGSSATFSAKNKTIMPDEYLRTWR
FT                   IAFIIRHPALAWPSMYRAMQKLSKAGFIDDDGMRGASFTNMSMEWTRTLFDWCREQPDE
FT                   SVTPLVIDANDVIHNPGAVVKFCEKAGLDTSFMQFEWNGAEKKSESWAAETANADTPEE
FT                   VAFHKTAASIMLSTLEESTGVVKDKAPASVDIDAEVAKWRLEFGDEVAELIEKATRDSM
FT                   PDYEYLKANRVTA"
FT   CDS_pept        join(complement(1029971..1030094),
FT                   complement(1029721..1029926),complement(1029503..1029652),
FT                   complement(1029424..1029443),complement(1029338..1029374),
FT                   complement(1027993..1029090))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672472"
FT                   /orf_name="Pc13g04310"
FT                   /product="Pc13g04310 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP91500.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001830AD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H286"
FT                   /transl_table=1
FT                   /translation="MSSEGGSGINKRAEKECSLTPLKILGLIENIKMSYSSQIMIWYRN
FT                   TYQDLSKDEILLNLDTPGVMEMLLCRGGQPDTISIELGVSYISFKLYIWSLVFPSFSVA
FT                   GIEKYPVELYTISSSTHCETSPGLGWLEPRRVGKHIKRLSRKSRQFMNSFISIRNMSAL
FT                   PRTRSLTSHSSILEAQANRLASSIAKTNASKKSVDLLYAFRSYTLDTIMCFTFGNCVNA
FT                   LDAPAFSDPLILAMDASLRMLPLMKNFPIIRDLIFAIPPSLVMRLILNSQKLAPRLYQV
FT                   RDLVQQQLQVVLNCPSKLDTVPHQTLFHRMLDPESYRSKQVLNMTELHDEGFTLIFAGA
FT                   NTVADTLLMGHWHLMQNQALLTQLRTEILTVWPDEKQPSLADLETLPLLTATIKESLRF
FT                   IPSGVSLTRVVPPGGAVIGGKQIPGGTVVGMAILHVHQSAEVWGADALVFRPERWLESA
FT                   EQANARNGKSELDHWLVAFSRGPRMCFGMNLAWAEMYIALATMIRHFDLTIDGTTAEDM
FT                   QWRECIAAYYPNRHLHAWCRPVGSGEV"
FT   CDS_pept        join(complement(1033206..1033300),
FT                   complement(1033058..1033153),complement(1031838..1032981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825167"
FT                   /orf_name="Pc13g04320"
FT                   /product="Pc13g04320 protein"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="CAP91501.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniParc:UPI0001830AD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H288"
FT                   /transl_table=1
FT                   /translation="MDLSKTLIRTVARAFYETRHILVVDALFLHSVLHAEDLAFLMGMQ
FT                   QKDLRKLCAKLREDRLIGVSTRAEIRDGSTRPVNREYYYIPLHPVVDAIKYKVSKLTAI
FT                   IKAQYTPSEERKEYICLRCKSEWTELDVLSLVSEEGFECQNCSAILERTEDVKGAEGMD
FT                   STGHEKNSKLMAQLDNMLKLLKQIDAVEIPPNDFETAWDHKVEVARNQHTHPVRAAIAV
FT                   PPKPQDITRPNAKTDAAALEISLTSSEEKSAAEQADEAARKAALEKQNALPVWHTHSTV
FT                   NTTQVGSQIKTDVGTVVKPELADEDQKPSVDALDDKVAAYYAEMEREKELQAQADASSA
FT                   DEDSDEEDFEDVEGISGPSGPATPAIAAPATSSGAAGIKREHEATSSGPPSSTGTPSTP
FT                   ADDGPVAKKIKVEPDIKPDPDAKIEAEVKKEAEESDEDDEEFEDV"
FT   CDS_pept        join(<1033861..1033958,1034015..1034218,1034276..1034730,
FT                   1034851..1035502,1035567..1035804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672473"
FT                   /orf_name="Pc13g04330"
FT                   /product="Pc13g04330 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP91502.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001830AD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H289"
FT                   /transl_table=1
FT                   /translation="RDLPTDTMADNKGTGGGGGGRRKNRDMGRAEWSRQAIDKRQRHEE
FT                   KAEVKRRKIENGEEVKLPIYATQFSKEEIDSEERRPKKKVALLMGYSGTGYSGMQLNEQ
FT                   QRTIEGDLFTALVNVGAVSKANAADPKKSSFVRCARTDKGVHAAGNVVSLKMIVEDEDI
FT                   IQKINAELSPQIRVWGYEVTSKSFSCYQMCDSRVYEYLMPSHCLVPPHPSTYLGKKIVE
FT                   LADKAGELDAVKTRQEEVASYWEEVDEKYITEEPAQQETSEQPVAEQSADAEAQKPFVM
FT                   DPRQKAINDAIKSIKAAYLTAKRAYRAPASRIARLQECLNRYEGTKNFHNYTIQKTHKD
FT                   PSAKRHIKSFKVNTTPIIINGTEWLSLKVHGQSFMMHQIRKMVAMATMVVRSGCHPDRI
FT                   TETYGPERIAIPKAPGLGLLLERPIFDAYNNKAQGLDRQPINFQKFEAEMNEFKQREIY
FT                   DRIFREEEESAGFGSFFNHIDHFPAGYFLYVTSGGIPAAKLATAPTPAGPGSPKAGNKT
FT                   RGAPRQQDALAAVEVESEDEGDAPAGGEQEG"
FT   CDS_pept        join(complement(1040841..1044380),
FT                   complement(1040623..1040750),complement(1040421..1040571),
FT                   complement(1039787..1040364),complement(1039633..1039736),
FT                   complement(1039377..1039576),complement(1038756..1039313),
FT                   complement(1038653..1038704),complement(1036485..1038601),
FT                   complement(1036218..1036426))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1045689..1045849),
FT                   complement(1045201..1045597),complement(1045069..1045146))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950904"
FT                   /orf_name="Pc13g04350"
FT                   /product="Pc13g04350 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP91504.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI0001830AD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H290"
FT                   /transl_table=1
FT                   /translation="MSHPTEKEKMLRGELYRAFTPELIAARSRCKWACNRFNKSDEVPR
FT                   RRLVEMWRDITDDKTPLPPKLDDPAADEALFAKEPWVESPVHIDYGFNVKLGEGVFVNF
FT                   NCVFIDTCPITVGARTLFGPNVSLFSGTHPLDPALRNGTEGPETGNPIVIGEDCWLGGN
FT                   VTVLPGVTIGKGATIGAGSVVTKDVPAFHVAAGNPAKIIRRIETTMKE"
FT   CDS_pept        join(1046176..1046983,1047045..1047130)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950905"
FT                   /orf_name="Pc13g04360"
FT                   /product="Pc13g04360 protein"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91505.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI0001830AD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H291"
FT                   /transl_table=1
FT                   /translation="MFSNPSATTSGAEPNKAPNFTHISRPLVHDRTNSNTSSSSSDVST
FT                   DAPNPDTSIYPDGKMSLAGISLRAMLLGTSLGLSASMALYLSTVYYTPLWRVPFFIASL
FT                   SLFHFLEFYVTAQHNTRYATVSAFLLSSNGWAYNVAHGSAIVECIVSHVFWPGQTAAGR
FT                   MITVTEPFFGSSVSLLLIVGFVLLLIGQVIRTVAMAQAASNFNHHVQSQHQEGHVLVNT
FT                   GLYRYLRHPSYFGFFWWGLGTQLVLGNMVCFVGYALVLWQFFSSRIKREEAYLISFFGD
FT                   EYVQYRKVTSVGIPGI"
FT   CDS_pept        join(complement(1049468..1049541),
FT                   complement(1048404..1049401),complement(1047902..1048350),
FT                   complement(1047309..1047851))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129534"
FT                   /orf_name="Pc13g04370"
FT                   /product="Peroxin-8 Pex8-Penicillium chrysogenum "
FT                   /protein_id="CAP91506.1"
FT                   /db_xref="InterPro:IPR001759"
FT                   /db_xref="UniParc:UPI0000F58D1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H292"
FT                   /transl_table=1
FT                   /translation="MATERSLATLLRSLQATSSFQDAASLLPTATSFLSMLGNPLNLTL
FT                   LSSQLLTAPSLWSQPVDLQSCRQILSVFNTAAIAVLQSDTTEEPRIPYGRNRKIEYEAW
FT                   VKAVAEGADDKSPRWRHTLLLGGILMGFEGQNRRGLPRHIRVKLESALVRAAQLALEEV
FT                   GSETGIDGQCITMVLNYTFELLSDLERSKLDYDRLLPTMIQSAYLSSEGLEGGYFLGSI
FT                   DQDVVEAPGKQFRWSSNSPTFGIVSAVAARPLVSTLGPLSRLIAHSVDNVRDPRIVGQT
FT                   VDYLADFVRTLMVQWRQNKLSEIDVAEEAEFLDAESREITLPALWKMLRNCLYSVVIAL
FT                   RAVLGRTINDPALAANSSAPYISMQCLHILRNMYFISSRVGQNASSQQTFVMLAAIDIL
FT                   SQYPVLAENFLRSIKPSDIGQIPAHPVERCLDLFFLNVAEHFPLVLSLETNEELLLSAA
FT                   FPYLAAGANSLLLEIFEAAHSLVLVVFAIPHNSELATKHLPFYIENLFAVFPNNLSARQ
FT                   FRLAFKTVIQITAPPSPLANTQPLLPSILLEVVHDRALKASSTPIPPQGPNPDMSQSPP
FT                   LSEQAVLTLALLDSLSFLRVEHLKEWLPLAGQLINTISDRNMRHLCIDRFWEALAGGEM
FT                   DVDRSHCCVTWWSTEGGRELVLFGAETAPDESDESGPYMSGAVGGVAPESKL"
FT   mat_peptide     join(complement(1049468..1049484),
FT                   complement(1048404..1049401),complement(1047902..1048350),
FT                   complement(1047312..1047851))
FT                   /db_xref="UniProtKB/TrEMBL:B6H292 "
FT   sig_peptide     complement(1049485..1049541)
FT                   /db_xref="UniProtKB/TrEMBL:B6H292 "
FT   CDS_pept        join(1049856..1050145,1050214..1050334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950906"
FT                   /orf_name="Pc13g04380"
FT                   /product="Pc13g04380 protein"
FT                   /protein_id="CAP91507.1"
FT                   /db_xref="InterPro:IPR019334"
FT                   /db_xref="UniParc:UPI0001830AD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H293"
FT                   /transl_table=1
FT                   /translation="MANNRIPINYEVPSFPSLYDPLPAHHQQAYYLYYTKDIWRFTFFW
FT                   TLIFYAATHLTVSGCAALTHFRNWNVIWIVPLVYIFIAALEALIAGSIIGVVLGAVYEA
FT                   GNFRMSTWLPMIWGGVNVMVLIVTSFPMQGGL"
FT   CDS_pept        join(complement(1052513..1052597),
FT                   complement(1052315..1052430),complement(1052058..1052258),
FT                   complement(1050592..1051995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825168"
FT                   /orf_name="Pc13g04390"
FT                   /product="Pc13g04390 protein"
FT                   /protein_id="CAP91508.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001830ADA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H294"
FT                   /transl_table=1
FT                   /translation="MAYYEDNAGDGPGRFGKNFDGPVGPRRPRLVTDYGSSMVQWMRTQ
FT                   QPRYKGGHRLETERPSASFAVDVLPPMARPHSAVDTIPVRHLHQSIGKSKKPIVVVRWT
FT                   PEGRRLLTGGHTGEFMLWNGTAFNFETVMDAHYDQIQAGVTSLAWAHSQDWLVSGGQRG
FT                   DIKYWRPNFNNVETIDDAHHDAVRDLAWAPSDTKFLSASDDTTLKIFDFATRTADETLT
FT                   GHNWDVKSCDWHPTKGLIVSGSKDHQVKFWDPRTGRCLTTLHSHKNTVTSTRFSRVNSN
FT                   LLATSSRDQTARVFDLRMMRDICILRGHDKPVSSLTWHPIHSNLISTGAEDGSLYHYLL
FT                   DEPHLPAGQIPTVAPYDSPDPANTPPQVIYPAHRIQYAHGATIWSLDWHPLGHILASGS
FT                   KDNFTRFWSRSRPGETSYMKDRFHIGEEAAEAQGTWNRGFGRKQMRDDEEQEMQDEADS
FT                   LVDQRRPGGPALPGIQSAPPAGPQPDVVGLLPGIGSAQPRQPGMDGGAMSGMDPGRLAA
FT                   LMSSRPPSQSSTPTPAMHGFPMPQGMTGTPPMNMDLAQLQKQLQGFPMPQNLNLQALAN
FT                   NPGFPGGFGGLPGLQGGGTPDGNRR"
FT   CDS_pept        join(1053048..1053285,1053335..1053379,1053480..1054430,
FT                   1054478..1054662,1054761..1054784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950907"
FT                   /orf_name="Pc13g04400"
FT                   /product="Pc13g04400 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91509.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0001830ADB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H295"
FT                   /transl_table=1
FT                   /translation="MTTRTGAIASAREESQLNSRKGVQNETEVALPSTSTAKKRSKYRH
FT                   VAAYHSESRPSSLSREADVLPNFLGFRNLMVLVLVAMNLRLVIENFMKVDVVLGSILFA
FT                   SVPCHLLVAYIIELSAATAAKQTVGRQKKTEKEKEHDQKVFQSTWPYTAFLHTLNATLC
FT                   LAVTSFVVYFYIHHPGIGTICQLHAIIVWLKNCSYAFTNRDLRLALLNPSADPGLPKIY
FT                   SSCPYPRNITINNLAYFWLAPTLVYQPVYPRTASIRWSFVAKRLAEFVGLAVFIWLLSA
FT                   QYAAPVLRNSIDKIAVMDIASILERVMKLSTISLIIWLAGFFALFQALLNALAEVMRFG
FT                   DREFYTDWWNSSSLGMYWRSWNRPVYLFMKRHVYSPLVGRGWSPLAASGMVFTLSAILH
FT                   EMLVGIPTHNFIGVAFFGMMFQLPLISLTAPLDNMRGPEGRVIGNCIFWVSFCLVGQPL
FT                   GALLYFFAWQAKYGSFSLGMYS"
FT   CDS_pept        join(1055142..1055173,1055236..1055371,1055473..1055760)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950908"
FT                   /orf_name="Pc13g04410"
FT                   /product="Pc13g04410 protein"
FT                   /protein_id="CAP91510.1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="UniParc:UPI0001830B82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H287"
FT                   /transl_table=1
FT                   /translation="MVAFIVPGNYGAVIGVALGAIPVLGFVHGNITGSLRKQAKVPYPH
FT                   SYASMELCRENAKAEQFNCAQRAHTNFLENASQTMLFTLVAGLKYPEWAAGLGALWVFF
FT                   RALFLYGYVYSGKPQGKGRMIGGFFWLVQGALWGLSVYGVGRPLLSF"
FT   sig_peptide     join(1055142..1055173,1055236..1055290)
FT                   /db_xref="UniProtKB/TrEMBL:B6H287 "
FT   mat_peptide     join(1055291..1055371,1055473..1055757)
FT                   /db_xref="UniProtKB/TrEMBL:B6H287 "
FT   CDS_pept        join(1056067..1056223,1056279..1056952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978331"
FT                   /gene_name="pyrG"
FT                   /orf_name="Pc13g04420"
FT                   /product="Orotidine 5-phosphate decarboxylase pyrG-
FT                   Penicillium chrysogenum"
FT                   /function="orotidine-5'-phosphate decarboxylase activity "
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /protein_id="CAP91511.1"
FT                   /db_xref="GO:0004590"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniParc:UPI0001830B83"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A4"
FT                   /transl_table=1
FT                   /translation="MSSKSQLTYSARAQSHPNPLARKLFQVAEEKKSNVTVSADVTTTK
FT                   ELLDLADRLGPYIAVIKTHIDILSDFSQETIDGLNALAQKHNFLIFEDRKFIDIGNTVQ
FT                   KQYHNGTLRISEWAHIINCSILPGEGIVEALAQTAQATDFPYGSERGLLILAEMTSKGS
FT                   LATGAYTSASVDIARKYPSFVLGFVSTRSLGEVESTEAPAQGEDFVVFTTGVNLSSKGD
FT                   KLGQQYQTPQSAVGRGADFIISGRGIYAAADPVEAAKQYQQQGWEAYLARVGAQ"
FT   CDS_pept        join(1058031..1058283,1058406..1058501,1058577..1058782,
FT                   1058872..1059291,1059343..1059691,1059748..1059932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950909"
FT                   /orf_name="Pc13g04430"
FT                   /product="Pc13g04430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91512.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830B84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A5"
FT                   /transl_table=1
FT                   /translation="MASEEKAIGISSGVDTGFDVGKTKHVDPTMEKHAHDADEALKALG
FT                   DLQGETIELDEATNRRLLSVIDWHMMPIMCFVYGMNYLDKTTLSYASVMGIKKDLNLEG
FT                   DQYQWLGSLFYFGYLAWEYPTNRLLQRLPLGKYSAACILIWGLILSCFAAVSNYQGAIA
FT                   IRFMLGVFEAAVTPGFALLTSQWYTKQEQGSRVNIWFSFNGVGQIFGGVVAYGIAVGTE
FT                   KHGSSIEPWKIVFLVTGLLTICLGLVFLWIVPDNQLNARWLNEEDRILAVARVRVNQQG
FT                   IGNKHFKLYQVKEALLDPMTWAFFFYALIADIPNGGITNFFNQLITSFGYNEKESLILG
FT                   VPGGAVEIVALLLNGYVGHIAGQRILASLGGLVAAIVGMLLIVALPLSNNVGRLIGYYL
FT                   TQASPTPFVALLSLISSNVAGYTKKTTVAALYLIGYCAGNIIGPQTFRPKDAPRYVPAE
FT                   VTIIVCWGVCLFLLVGVWMWYRRENQKKLLFTARPEYVRLENQE"
FT   CDS_pept        1060670..1061692
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825169"
FT                   /orf_name="Pc13g04440"
FT                   /product="Pc13g04440 protein"
FT                   /protein_id="CAP91513.1"
FT                   /db_xref="UniParc:UPI0001830B85"
FT                   /db_xref="UniProtKB/TrEMBL:B6H296"
FT                   /transl_table=1
FT                   /translation="MASVTCLALEPSLASKCEPLVTELKGYPSISPSEMAKVKRIDPPG
FT                   NEPGRRQSQTSTSTSISHSRSASRSTVPSRPNSRRSSFHSPRRAVPNAAIVPITTTRSS
FT                   IQDKRESLLALHRESCRLFQGDTSNRSSTETRPSLHRTASATYRSHHESHASEKGSSAP
FT                   SSPIMPSCSGFRFESESTLPSSTSPPHFITPRDRSNTLPSRHHHSPSSSSIHVPATVME
FT                   WTSPDTRRREYEKIDRASSGVRGLWRRVAPRCFQSRDSRTPFFEEGKTEREGSVRRFRM
FT                   DIPEDEEPEPESQGKSQTQLLDFLGKTSTSKSNSDSNSPDGPRRRWTCLRSKTSPLPNA
FT                   "
FT   sig_peptide     1060670..1060711
FT                   /db_xref="UniProtKB/TrEMBL:B6H296 "
FT   mat_peptide     1060712..1061689
FT                   /db_xref="UniProtKB/TrEMBL:B6H296 "
FT   CDS_pept        join(complement(1063598..1063629),
FT                   complement(1063123..1063483),complement(1062874..1063047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950910"
FT                   /orf_name="Pc13g04450"
FT                   /product="Pc13g04450 protein"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91514.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0001830B86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H297"
FT                   /transl_table=1
FT                   /translation="MVRELKHHEKKLLRKVDFHNYKSDGNHREHEIRQRYLLQDPMDYR
FT                   KYNALCGSLRQLAHKLSQLDPDADPLRKKLESELLEKLWRMGILKQSREQGAGLSKVER
FT                   EVTVSALCRRRLAVFMVRSGMVETIKAATTFIEQGHVRVGTEVVNDPAFLVTRNMEDFV
FT                   TWVDSSKIKRNILRYREKLDDFDLL"
FT   CDS_pept        join(1063858..1064844,1064904..1065434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978332"
FT                   /orf_name="Pc13g04460"
FT                   /product="Pc13g04460 protein"
FT                   /protein_id="CAP91515.1"
FT                   /db_xref="UniParc:UPI0001830B87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H298"
FT                   /transl_table=1
FT                   /translation="MENQADTPSKMSGRPRVDLEPYKAEIIGLYEKKMKSDDICKHMKR
FT                   QHDIQISARTLTKRLQLWGVKKKMENNSSNEALHARIKNLFFDVGLTDQEIVTVLHDEG
FT                   YDVSARTLRRLRHQLGIRLRLDSPTQQQAQVQEILDALTEEMDKGTIEGYGKELLHNHF
FT                   RSKGYVFARDRLYSVYRMLRPDTVERRTRDMHRPPPPPKILAGPNLTWHVNGYSKLANF
FT                   GFRIHAELDAYSRYVLWIHVGVDAHASVGVLKNHLDTVASKNRQPRTLRSDLESEVPLL
FT                   ADAHFALRRVTEPDVQREQCCAPGRATDTHRIESWWAQLAKSVVTLYHNYFRELHNQGL
FT                   FSSTVIPEQVALLAIYMPTLRSHIKSYVQTWNMHNIRKQADHPERAPGKPYMNYHHPPK
FT                   GVENFGLPADVPMLQSMQQNHADYDTEQYLPPDTLHWCEMQLQQLGFDPHKPPARLPGD
FT                   LQPFRSVYLALRERAWHHERSGAEPKLAVCAFPGQGLRGYFPSGHAR"
FT   CDS_pept        join(complement(1073680..1073910),
FT                   complement(1073194..1073607),complement(1072354..1073138),
FT                   complement(1071794..1072248),complement(1070587..1071737),
FT                   complement(1066644..1070537),complement(1065749..1066594))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950911"
FT                   /orf_name="Pc13g04470"
FT                   /product="Pc13g04470 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91516.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001830B88"
FT                   /db_xref="UniProtKB/TrEMBL:B6H299"
FT                   /transl_table=1
FT                   /translation="MRPLSLASGLSGDGAIPPDSLEAIAIVGLATRFPQQATTTESLWE
FT                   LLLQARSTWSSIPKERFNSDAFYHPDPEHGGTFHVQGGHYLSEDPAYFDGSFFNITKNE
FT                   LLTLDPQQRLVLENVYHALENAGIPLTSAVGSNTSVFVSGFNHDYLGILNSDPETTLKY
FT                   KPTGVTNAILSNRVSWFFDFKGPSMTIDTACSSSLVALHLAVQSLRARETNMAVVSGVS
FT                   ILENPTETIGMSHHGLLGPQGRSFSFDSRAEGYARGEGVGTVVVKPLSAAIRDGDTIRA
FT                   VIRETGVNQDGRTPGITVPSADAQERLIREVYWRAGLGLENTRFVEAHGTGTSTGDPIE
FT                   AGALAKAFKCQRETPLYVGAIKSSIGHLEGGSGVASIIKSILTLESGIIPANFDMKQTN
FT                   PSIPAADWNIAFPTEALPWPSPGLRRVSVNSFGIGGTNAHCILDDAYHYLNDRRLTCAH
FT                   RTTSTVPTTQKIKSRLLALFCASPTFTSSTYTSLVEKPKVFLLSAFDEDGVKRNAAEFA
FT                   KYLNRRTSQSVLHDHLLDDLSFTLSKKRSQFPWKSFIMATSVKELAWNLSESNFAKPTR
FT                   AARVPEVEFVFTGQGAQYQAMGRELMVYPAFQESVEEASEYIRRLGSPWSLLDELLTER
FT                   ESPRVNLPEIAHPLCTVLQIALVDLLASWQIFPKRVTGHSSGEIAAAYCSGKLSREGAW
FT                   KVAYYRGYVSSKQLSANGAMMAVGLGASQLQPYLDSVKGKNTGELIIACHNSPKNNTVS
FT                   GDDAMIDRLRSLLDADGIFARKLNVKNAYHSAHMHAIAQDYLRLMGTLPYGRRLAAPHQ
FT                   VHMFSTVTGHQVKEEHLPAQYWVDNMVSPVLFTSGLVAMTSNASSSHGTTDLADSLRLL
FT                   VEIGPHSTLQSAIKETLASKSPKLEFKYLGVLKRTNHSLNTLLTTVGFLASSGCELDFH
FT                   AVNQAPHSKAKRRPRLLVDLPPYIFKHTEKILFESRLSKNIRTRKFPRHDLFGAPITDW
FT                   NPTAPRWRHFVRLNENPWLRDHMVTGNYVYPGVGYLIMAIEASRQLAGEEKITGFRLQK
FT                   VNIRRALIIPDTKEGIEVSLAMATVEDSASSRTWRRFQITSYNASSDEWTDHCTGHITV
FT                   DHETASDPVDNGREAEEESRAWGSEHFRANETCTKSMAFKSTYNNLQTSGLNFGPLFRN
FT                   LADVRASGCGLGKVVGSVTVPDIAQSMPKQYLHSHLIHPATMDSMIHLMIAAVLDFTGK
FT                   STLDQIRLPTFIRDVWVSADLNSAPTHKFTGHASVSTAESDKFEGQIQMLDEGTNRHRI
FT                   RMDGIELTPLESGLAENSERKLCSAIEYKPDVHFLDSKSACALTSLDASDDTQALYWVK
FT                   RLQLATMLYVMDALKELGDLHVTKLDLHMRRFFDWMEHVQTMLKRDEILHLPYNEFLEI
FT                   AQDEALKEAIGKEIEAHSAEGAITARMGRNIAKVVRQETDPLDLMFGQDAVMEQVYKEG
FT                   LHLYNLPQHLQTHLSLIRHQHSELNILEIGGGTGSFTAEVLAVLSPDLAKTKGNIASYT
FT                   FTDISSGFFEKAKQRFQPWSDIMNFQSLNIERSPVDQGFQLGTYDLIFAGNVIHATANL
FT                   HNALSNLRSLLKPGGQLIMQEGIRQDFLWYPLVFGQLPGWWLGDEPCRQWCPYIPAEEW
FT                   NPLLLKAGFSGIDAEYPSSNDPDLTWQSILVSSAVKIPTEKPSNTAIILTLGTLKARQV
FT                   TENLQVLLPELGYTSILVKEPMEVENSILSDALCISLMDLEYPYLFDMTEAEYDTLKKM
FT                   LSECQNLLWVTCNPLTQPHTSMSFGLLRTVRRERDADGSNIVTLTEAEPDVASPQNLAT
FT                   AVGKIIKRQFVDKPENDRHAEYMLQNGLIHIGRLNEWEAADQFLAAQSSQQAPQLQRLG
FT                   DYDTPIELQEAAVSTGEYHWVIDTQQEESHKDTEVEVEIRAIGLSSDVSAGRLANEIAG
FT                   VVSKVGSEVEDLAAGDRVIYISGDKKGGSVRTHGRADQLQLVRIPDEISFEVAAGLAWA
FT                   YATAIQGLGEMARLGPENTILIHTGATDISQAATQYAQMIGATIYATVATVEERDLLVS
FT                   DYGISKERIFSRKDLKFVKSVMRCTNHTGVDVVFNALSGEALRGSMACLAPFGTFVDVS
FT                   NPNKRADTTVEMASLPRNVSVHTVNVPLMAQHRPKSVRLLLTEALRLYSEGKIGQLRTT
FT                   TVLDFTQIKGGIRTAQSGEAAKVVIAPNPSNMVPVVPRPIVPCHFDPDASYVLAGGYGG
FT                   LGRSLARWMASGGATSLIILSRSSASSQEKMELIADLDRMGCKVHSLVCDVADVSSLQR
FT                   LSGEAFSDLPPIKGCIQASMVLRDGAFTGLSFNDWQAAIKPKVQGSWNLHTVLPDDMDF
FT                   FIMLSSVAGIFGNRGQSNYAAGNTFQDALAAYRVSKGMQAASINLGSVSNVGWVAENRS
FT                   SMRTHTATLFELLREEEVHATVDFLIRQDGGNASACSQLVLGLPTAEMCRQNGVPLPTY
FT                   LNYSMFTHFRSTVTAKNSEVSQQKSVSVAALLSAADGFEGAVIVVSDGIVERLASLLAI
FT                   PCSELDAQRFGFGGIDSLVAMEFRAWIVKELKAEVSLLDIMGAENIRALSEKIAGRSRL
FT                   IAGGSSMSS"
FT   mat_peptide     join(complement(1073680..1073865),
FT                   complement(1073194..1073607),complement(1072354..1073138),
FT                   complement(1071794..1072248),complement(1070587..1071737),
FT                   complement(1066644..1070537),complement(1065752..1066594))
FT                   /db_xref="UniProtKB/TrEMBL:B6H299 "
FT   sig_peptide     complement(1073866..1073910)
FT                   /db_xref="UniProtKB/TrEMBL:B6H299 "
FT   CDS_pept        join(complement(1078145..1078314),
FT                   complement(1076939..1078034))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950912"
FT                   /orf_name="Pc13g04480"
FT                   /product="Pc13g04480 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91517.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A0"
FT                   /transl_table=1
FT                   /translation="MQLLRLLVAVAVVLFSVVVIAAEDYYKVLGLAKSASERDIKRAYR
FT                   TLSKKYHPDKNPGDDTAREKFVEIADAYDVLSTSALRKVYDQYGHDGVEQHRKGQAAGG
FT                   SHDPFDLFSRFFGGGGHSGHAPGHRRGPDMEVRAALPLRDFYNGREINFLVEKQQICDS
FT                   CEGTGSKDRQVVTCDRCSGRGMVIQKHMLAPGMFQQVQMQCDKCHGQGKKIKNPCPVCH
FT                   GNRVVKNEVETGATIEPGMGKGTRLVFENEADESPDWVAGDLIVVLDEKEPELGTSEEE
FT                   KTDGTFFRRKGKDLFWKETLSLREAWMGGWTRNLTHLDGHVVRLGRGRGEVVQPLAVET
FT                   IAGEGMPHYSEGHLHDHHDENDEAGNLFVEYTVILPDQMESGMEKDFHALWEKWRKKIG
FT                   VDLAKDSGRPVVSPPAEDKDEL"
FT   mat_peptide     join(complement(1078145..1078251),
FT                   complement(1076942..1078034))
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A0 "
FT   sig_peptide     complement(1078252..1078314)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A0 "
FT   CDS_pept        join(complement(1079550..1079903),
FT                   complement(1079115..1079528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950913"
FT                   /orf_name="Pc13g04490"
FT                   /product="Pc13g04490 protein"
FT                   /protein_id="CAP91518.1"
FT                   /db_xref="UniParc:UPI0001830B8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A1"
FT                   /transl_table=1
FT                   /translation="MTGFHFSGQQLDNDLVTSISCLLDAADIPNLLWGNYLLTIYGVPT
FT                   VVDVSISLQRSVVGTLLILRQGVSFVVPDTLIEISYSTLSKAGFLPCTQSSDCPYSNTL
FT                   RCPPPVTHLHIDDEKSDVLWEFPDFEIASHNNNSDIWCASDTRLPPASLGRGQGRFPPH
FT                   LYSVQIPSALRYCEALILLLCRDYGSVCETYWMAILTYMLEFVDGTDILDEEGLSEGYR
FT                   PFYRALKQADSRMYLLLEELRRDLIERRILPVK"
FT   CDS_pept        join(complement(1082538..1082931),
FT                   complement(1080637..1082438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950914"
FT                   /orf_name="Pc13g04500"
FT                   /product="Pc13g04500 protein"
FT                   /function="lipid binding"
FT                   /protein_id="CAP91519.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="UniParc:UPI0001830B8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A2"
FT                   /transl_table=1
FT                   /translation="MPSETEPLLPRYEDDTSRQRRLHQKLHSYQMIRAISEGYMPTTEQ
FT                   TIANLRTLLASDVLNLRNQDIGSVGRQLVRDSRLWIQAFIEFLEQKNGQDQLQQFLWRL
FT                   ARSRVEVDSERVSRQAAHVKARADTKAAYDSFRTVGGLLLTNADFRLFVDDIVTVGRQI
FT                   FADTAESLAESSKRVAEQAKPSEEEEQALQGAGADEGHALSKAEVKEEAAHVADVAGEG
FT                   IAQTSHDAVKSAKEHLSGRERDTLLFRLKQAVQRLRERTDYSDSVSTLTQLIARYARIY
FT                   ADVAENTASVAQEELGVNDDLRRAVDEFWIVLRSFGSAEEWDRLQEKFHNVLRHANKDP
FT                   EFDNLLKEVGTSLHDMLTNPEFFDSAPQKLDELKQHSGRVSSETGLRKDVDDFLAQTKC
FT                   TLRTVPEDPAVSKLINATKKIYQDACGAYNDKKADLPADLVNVFFPVLLRTIQYIPIPR
FT                   LEISAPEMDLLLENLVLEPGHTVNFSSFLPYRMHLLTRNDIDVVKTHSKRTETLMKTAF
FT                   TVTVQGLNISAEDFGYWFRAHTGFFHLKDEGIASFYLDRRGIDISLDIEVGRDRLEHIF
FT                   SLRGVRVCIHKLDYTVKRSKWRFLVWLTKPFLKHLVRRVLEKKIAEEIVAATFALNREL
FT                   VFARERLRATRIANPQDLATFVRAVLARLKPADSDVEARIGIEPQGVFKGIYAPGSIVK
FT                   TWHEEATRAQEAIEEGDETQGLGHTWHNDIFNVAGRY"
FT   CDS_pept        join(1085120..1085205,1085284..1085503,1085581..1085659,
FT                   1085778..1086126,1086199..1087273)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978333"
FT                   /orf_name="Pc13g04510"
FT                   /product="Pc13g04510 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91520.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A3"
FT                   /transl_table=1
FT                   /translation="MARYPLLPTQQNRTVHATPAPFVNHTSPADANYDTANPSYIRKYL
FT                   RTYGLTPPRAEGYETQKARCLAQLGLKSTPIEKFLYLSTLRKNNVHLFYRLVTDHLREL
FT                   TPLIYTPVVGEACQKWSEIYQQPEGMYLSWEDRGNLASVIANWPESNVEITCITDGSRI
FT                   LGLGDLGINGMGIPIGKLALYTACAGIRPEATLPLTLDLGTGNKALREDPLYMGSRRDK
FT                   VSPEEEREFLDELMAALTERWPGIVIQFEDFKNPFPALERYRDMYTCFNDDIQGTGAVI
FT                   LGGVINAVKRSGLPCKDHRAVFFGAGSAGVGVARQIVEFFMREGMTEDEARNCFYLVDT
FT                   KGLVTADRGDKLADHKVYFARRDNNGEQYKTLDEVVDHVKPSILMGLSTMGGVFTPEIL
FT                   RKMADWNTAPLIFPLSNPSSKSECDFETAIANTDGRCLFASGSPFPNCTFTNSAGETRT
FT                   YYPGQGNNMYVFPGIGLGSILSKAVRVTDSMIYASGEALSAALNGEELERGLLYPDITR
FT                   IREVSVVVTRKVMRAAQEDKVDREIALRSLSDVELDNWIKARMYDPHTEVRALEREVGH
FT                   LLSSLGTISPPMTASGSPTEEKNAKL"
FT   CDS_pept        join(1088148..1088219,1088294..1088396,1088558..1088977,
FT                   1089049..1089068,1089154..1089741,1089813..1089860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978334"
FT                   /orf_name="Pc13g04520"
FT                   /product="Pc13g04520 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91521.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830C46"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A8"
FT                   /transl_table=1
FT                   /translation="MPSSPLADPVKLPCGLVLPNRLSKAAMAELLAKNNQPTDPLVDAY
FT                   EQWSDGGWGSILTGNVQVDVNHMGSPFDPALHNEYKDNETNSVLVAQWKKYADACQKHG
FT                   TPAIAQICHPGRQSFRVAGRRGMFAQTLAPSAVPIKVGDSYLERLIGYLAWTEPKEMTT
FT                   QDVEMVIRQFVDTARLMADAGFSGIELHAAHGYLLDQFLNGKTNLRTDAYGGTPEKRTR
FT                   FVLEIISQTRKLVPATFAIGIKLNSADHSSTTFEETMTQIALLAEAGLDFMEISGGSYE
FT                   DPKMMGYGKANATEPKSSRTAAREAFFLEFSKEVRQRHPELVLMLTGGFRSRAGAEAAI
FT                   RDNACDLVGIGRPAAIDAKFPRLLLDESVGDDEARLPLNKAPVPWYTRFLPLHLIGAGA
FT                   ESIQNLGKGIATLAPPW"
FT   CDS_pept        complement(1090288..1091061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950915"
FT                   /orf_name="Pc13g04530"
FT                   /product="Pc13g04530 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91522.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0001830C47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A6"
FT                   /transl_table=1
FT                   /translation="MENDTQTLQMDHTLSHCPWQADKPQPISRDQWPEEGLQWGSDPSF
FT                   CYHGYSSPIGTWTEERLVQNLMRNMASFCTVMDIGFNIPEIIDEPSEKPILDPPELNGF
FT                   TLPMFQPSMVPRNRRLSETPSSPSSSSSSQGQISSPDNTECSRRASCVKPRTQSGQKKR
FT                   KCVQRPGQRLCHCRSEKRRREIIGERYKELCRIVPGLEKQSFTRKYVLEGAALWIQKLV
FT                   QGNDALHQQLEQLKEREKLNQLRLFPVEEDEKLGC"
FT   CDS_pept        join(1091863..1093256,1093315..1093556,1093738..1094022,
FT                   1094076..1094276,1094328..1094590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950916"
FT                   /orf_name="Pc13g04540"
FT                   /product="Pc13g04540 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91523.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A7"
FT                   /transl_table=1
FT                   /translation="MPPKGGITKREPPRRRKIALACESCRDKKVRCDGIKPICGPCARR
FT                   SYTVDQCVYKLDNARSASNDEYLKILHNRIRELEETCAKGGVTVPPGPSQDGDYRAPGS
FT                   QSHMGEDMDLDHLDAESRTSVAAEGLLGLGSTPVPSGPIPLSSTPTFQPPRFPAQRNIP
FT                   EAERYRSPHVTHLSPESTQPRAGSIYPSPSLNSHGNVTAMGAISVAEDEPSTDSPREQQ
FT                   YYGNSSVASFMRLAGESMPLQSYMSALRDSKSESSRSQGPDTGIWRDLGHPSVDLRFDD
FT                   FSLPPRSLADHLLECYWDRVHCLFPFFHRPSFEQAYENLWGSDKASKPELPQLNIGLGG
FT                   AFDCGPNSIVFHCALNCIFAIGCYFSDIPPADREAAVYSFFLRAKRFVNLDLLDIGTIG
FT                   VVQTLLIVSLLLQSTPYPNRCWNAIGLACRAGQGLGLHETTTHASNKPLETEIRRRTWH
FT                   SCVIMDMIVSMTHGRPSMTSHISPLPLPAMGTDSEEADPCELSGQPCDHKLGYMTFYVS
FT                   TIELYKILESILSEVYNAWQSRSNTTRTGSFSFCAFRLQFLTKERFIHLRLLLYRPMFT
FT                   QLCSDERAGSSRRSDSQSSERNIIYSTVFSKCAASCVMAAIDLVSLVYKTYRTNVTDAW
FT                   WYNGFYTSTAGFILIMSYSCHSIREQVDSQIVDESWRKCEEILAFMAIFSLSARNSLQF
FT                   LQVTHQHITQNYSATCRPGDPSMVSTQLHQRGNQQPNRPDLSSQPTEPIADEHNLRHGP
FT                   ANMDINLFSTWDEMSLGQEEFGFLGRFDLPDLASWFADIPP"
FT   CDS_pept        join(complement(1097027..1097146),
FT                   complement(1096880..1096974),complement(1096133..1096829),
FT                   complement(1094806..1096083))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672474"
FT                   /orf_name="Pc13g04550"
FT                   /product="Pc13g04550 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91524.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A9"
FT                   /transl_table=1
FT                   /translation="MYELGQSPESSRQTSPASRDHNPRKRGRTACTRCKTRKQKCDNEH
FT                   PACSNCLKAGVSCDKSSVREDKDRQNDYIRGLEERVMFLERKLVESDRSSDQNAAATHT
FT                   ASSLFSPQGGHTTPHTTTSGFDNNPVGEIVGLLALSASEAPAYVGSSSGLSLAADLGEM
FT                   VQTSVWNQFISRMQQKTSTTANNSRNTAGQAQGPTEQSSATQIRDRATRTEDLLPANVE
FT                   PPTDEMGARILETYFTRLHSRYPFLNRNQVWQIHVDRWRLAKIKREDLTRSDRFAIFKL
FT                   NLVYAIGATMLRLSEKYAYTTPERFYTAALQHVPTMCEARSIENIEAMVLLVVYHLRTA
FT                   SSHGMWYMIGLAMRTAIDLGLHRKANESNMDPFTTQMRRRLFWTVYYLERVVSMSLGRP
FT                   FSISDRHIDLDLPLEVDDDIEDPTLLTASLDPNKTTTLTFAIYLFKLRRIDSRIQHKIY
FT                   RADRPLSSLRPKMDPLYLELEQWKESALLRFSGPDLDYPMLHFNRAVRLLIQPFLPLLP
FT                   ITDPYYQICILAAGNICQSHKRLHQTLEYGHSFLAVQTVFMAGITLLYALWTHTDQVWS
FT                   VRMSNDIRACSTVLFVMGERAAWVKKYRDAFELLVNAAMEKLQGNETARNAGMAELMTA
FT                   QYGVNWNSTTAPGMSGSDKFPPVNPTGLAPDTTGATPQGCAGDDSEHAVRMALQLAPWI
FT                   DQDESDPLWVPDFETLENLSGTFWSHGDTRLFDPM"
FT   CDS_pept        join(complement(1098650..1099478),
FT                   complement(1098340..1098595),complement(1097612..1098278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950917"
FT                   /orf_name="Pc13g04560"
FT                   /product="Pc13g04560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91525.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B0"
FT                   /transl_table=1
FT                   /translation="MNRQREAEKALHDQTNILPFAQLMVVFTGLAISLLICMVDQNGIS
FT                   VTLPTISRELDAQNTISWAGTSSLIANTMFTVLYGRLSDIFGRKIMYISALVLLCIADL
FT                   LCGLSQSPAMFYVFRGLAGVAGGGVTSLTMIIVSDIVTLEKRGKYQGILGASLGIGNII
FT                   GPFLGAAFIMRSTWRGFFWLISPLAACSAVVGYFLIPNNARKDSFRENVGRIDWFGLLA
FT                   SSIGIIFLLIPISGGGSYFPWDSPMVISMLVIGGCSLVAFLLIEWKVATLPMLPVVFFK
FT                   NKVVSAIFLQSFLYGAVYQASLYYLPLYYQNARGWSPIASAAMTCPMVAAQSIFSITSG
FT                   QYISRVKRYGEIIWIGFGLWTLGSGLMLLFGTHTHPAVIAVIVAVMGAGIGFTFQPTLV
FT                   ALQAHCTKSQRAVVIANRNFFRCIGGSCGLAISAAILQATLRSNLPSKFAYLADSSYSL
FT                   PSRANLSATEWASILLSYSKASHAVFILQVPLIGVCFLACMFVRDRGLERPKELEEIEE
FT                   EKRKAQEERDAEAATSDYPEESVDHQAYRQTEKCHSASTFAEPFMPPSRAEPNTEGCGE
FT                   KEQHRGI"
FT   CDS_pept        complement(1100802..1101968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825170"
FT                   /orf_name="Pc13g04570"
FT                   /product="Pc13g04570 protein"
FT                   /protein_id="CAP91526.1"
FT                   /db_xref="InterPro:IPR004332"
FT                   /db_xref="UniParc:UPI0001830C4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B1"
FT                   /transl_table=1
FT                   /translation="MTEMYSGLHVGQRFCSLEEFKTLVRSISVRQHWELRVARSNKKSV
FT                   VIGCRSSANCFFRVVCRSNKNATYITSLQDSHSCRRSANSPAATPARSEASHVRFLLSE
FT                   IPKLFNMKSKIRAQDVVDAVKRYHGYDISMRQAQRALTKLQPRHAEGQDEHGLDIDMSA
FT                   GEQQSPEQSPESQGEGAHTYGEIPENRWLPEHLPSSLIDDDNMSPNETSNNHIPAPPSS
FT                   SQALPSPQQVQHVPIPTSNQHSFNQNPHSMNIPQSGVEYQTAASLPVGVVGPPKDYSQR
FT                   SDHDAVPQMILTNFKIEFTCTTCGTLNQSFFPNQGNVTGASYMTHHAVPNPGNVPRHAG
FT                   TTPQSGVGSSSNAVGESPAYDINASNPPSIQNAWPGGGLGVQIGPAHT"
FT   CDS_pept        join(1102430..1102466,1102520..1103505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950918"
FT                   /orf_name="Pc13g04580"
FT                   /product="Pc13g04580 protein"
FT                   /protein_id="CAP91527.1"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="UniParc:UPI0001830C4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B2"
FT                   /transl_table=1
FT                   /translation="MASYGLLGQPEEDALHKSRLLNVEEKPFKRISKRLLNPESLIVSQ
FT                   SSLPLTPPPEETDADSDATATEAEKQKRLEEWRHFREDVSLDFAAFEASIARVQFLLTS
FT                   NEQERQRYATERVQILSTMQSVRESTADLRSQLEEAQRLLSLRKTYDELTDKITSNRLL
FT                   KPREDQSANLQKLRLEIADLEKESKDYAMTWAERREQFGRIVDEGMQLRRLIRDEKEEV
FT                   ERREGMQEGEDGDEGDVASKGKASSGNTPPGHESDAVTPSQHGQDEAGRPSALHVEKSG
FT                   AAGAASPLRQVTTAQSDGAHEDTNMLDEGEIPAVSDGELSDLEEGEELPDDFGGKMDTT
FT                   "
FT   CDS_pept        join(complement(1103993..1104160),
FT                   complement(1103824..1103910),complement(1103656..1103757))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950919"
FT                   /orf_name="Pc13g04590"
FT                   /product="Pc13g04590 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="tubulin complex assembly"
FT                   /cellular_component="microtubule"
FT                   /protein_id="CAP91528.1"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007021"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="UniParc:UPI0001830C4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B3"
FT                   /transl_table=1
FT                   /translation="MAPRTQLEITTSSVIRLVKEEASYHNELQQQAERIKKLEADTTDG
FT                   DENREYTLKQEHMSLEETKKVLPTLKEKIVQTVANLEALIIEEGKKGSESNVEHITAAK
FT                   EAIAQAKTAQREIS"
FT   CDS_pept        join(1105292..1105349,1105414..1105490,1105571..1106530)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825171"
FT                   /orf_name="Pc13g04600"
FT                   /product="Pc13g04600 protein"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91529.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniParc:UPI0001830C4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B4"
FT                   /transl_table=1
FT                   /translation="MPAPSLLHLATATAIRFVKDLDDLGAMPYSLARPILLNIQNPEKL
FT                   HAMELASPHLAEEDEELWLELIKRDIPDWEKYHLPDNTNNWYGVYCDLRDQAQRSLDAD
FT                   AERMKMAIDGISAKRALLTPKLIPERKGLRMAGSRPSFRQRHATYNHRTGGGGVEKKPS
FT                   IFQPQKRNTALTMPTKSLNNRASQVKRAPIGLVEEHRRPAEQAAPKPPSKAQPLPPRIS
FT                   RRPGMSPPSLQHPMLAKNEARLRALTSTASAAASPRGASSNDASGVKKSPAVATEPKPT
FT                   LKRRATSPPHGAENPSASSSSRPAPCAPSSSSSSSSSSLPIPHTSSLPPSGPPSSGPPT
FT                   PRPGVIRRRPAPSIFMPAKRRQLS"
FT   sig_peptide     1105292..1105333
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B4 "
FT   mat_peptide     join(1105334..1105349,1105414..1105490,1105571..1106527)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B4 "
FT   CDS_pept        join(complement(1107893..1107904),
FT                   complement(1107730..1107783),complement(1107514..1107596),
FT                   complement(1107313..1107412))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978335"
FT                   /orf_name="Pc13g04610"
FT                   /product="Pc13g04610 protein"
FT                   /protein_id="CAP91530.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI0001830C4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B5"
FT                   /transl_table=1
FT                   /translation="MLIKVRTLTGKEIELDIEPDYKVSRIKERVEEKEGIPPVQQRLIF
FT                   GGKQMADDKTASEYNLEGGATLHLVLALRGGCAAKSM"
FT   CDS_pept        join(1108498..1108572,1108624..1108873,1108940..1109556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129535"
FT                   /orf_name="Pc13g04620"
FT                   /product="Pc13g04620 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91531.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniParc:UPI0001830C50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B6"
FT                   /transl_table=1
FT                   /translation="MTNEPQHVTADNQFQQLITHSENDPKKLQIAYENHRSNRNALFRD
FT                   QICQPGFCEWKEDEILSKVLEAEKGLTDFVDPRNNLAFWARPPKHIRNLVYKIQQEIGP
FT                   LIGPGLWLVPPHHLHMTTLEIRSALTGPEIDEIAASLQMSGLVAELASYTLTHRARLVK
FT                   PIISYDTSAIALSFVPAAGEEDRNVYSGKDDQFTYHHLRSDLYNIVTQSGCPIAARYTV
FT                   PSAHITIARFIAPSDPKKGESDSPKEFEKEASRLIEKIEDLNHELRSNVWKRLGNPCQG
FT                   QWVIGHEKGLELMKGRTWYGVGDSIVLGEGFV"
FT   CDS_pept        join(1110054..1110056,1110284..1110376,1110445..1110629,
FT                   1110691..1110730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672475"
FT                   /orf_name="Pc13g04630"
FT                   /product="Pc13g04630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91532.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI0001830C51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B7"
FT                   /transl_table=1
FT                   /translation="MVNIPKTRRTYCKSKDCHKHQQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKAKKQLALKRCKHFELGGDKKTKGAAL
FT                   VF"
FT   CDS_pept        join(1111874..1111933,1112011..1112038,1112090..1112151,
FT                   1112220..1112410,1112471..1112899,1112964..1113025,
FT                   1113137..1113209,1113265..1113404,1113465..1113578,
FT                   1113654..1113759,1113860..1114004)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672476"
FT                   /orf_name="Pc13g04640"
FT                   /product="Pc13g04640 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91533.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C52"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B8"
FT                   /transl_table=1
FT                   /translation="MAMWYSLGIAFFAAIGTFLFGFDTGIATTTIAHQSWIDYMQKPSN
FT                   GLTGAVVAVYIAGEAVGALTQTFIGDRLGRIRFMQMMCVVVTIGTIIQTASINIGMFLA
FT                   GRVLAGFAVGGMVATVPIYLSEISDPRYRGLIGGISGCGISFGTMMSNWVGYACSYAPY
FT                   GPIQWRLPLGIQIPWGVIMFVGLATFMPNSPRQLIRHGKIELARSEFARIRRGLVLHEM
FT                   EEEFGLMKAQIEYEMERELTSYREIFKLFRHRVLVSIAVQTMTSLTGVNVIQYYQIYGT
FT                   VAFLSNSVTTMYMTDQWGRRKMLIAGLAGVVLIEIYAAVMQRQFQHTDNRVGKGFAILG
FT                   IYLFVVCYYGMLNSTTWLYGAEVLPVALRSKVMGLAAASHFIVNVGITEAGPSAFANIH
FT                   ENYYYVFVACSAFFLVIAYFYFPETKQKTLEEVAAAFGDRVVDQEGTKRSISVVGETQH
FT                   IEATHGTAKAV"
FT   sig_peptide     join(1111874..1111933,1112011..1112031)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B8 "
FT   mat_peptide     join(1112032..1112038,1112090..1112151,1112220..1112410,
FT                   1112471..1112899,1112964..1113025,1113137..1113209,
FT                   1113265..1113404,1113465..1113578,1113654..1113759,
FT                   1113860..1114001)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B8 "
FT   CDS_pept        join(complement(1115980..1116360),
FT                   complement(1115823..1115891))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672477"
FT                   /orf_name="Pc13g04650"
FT                   /product="Putative uncharacterized protein Pc13g04650 "
FT                   /protein_id="CAP91534.1"
FT                   /db_xref="UniParc:UPI0001830C53"
FT                   /db_xref="UniProtKB/TrEMBL:B6H236"
FT                   /transl_table=1
FT                   /translation="MEDEGLGYAEVKSGTITSSSEGLWREGENIFNGQELVLGNIQLPV
FT                   WKGSKRGTPRYMLWVWIAGLPVMGPYENRNENPHWLSGDINVFGVEMKSGLSKSSILQP
FT                   DSICNRRQPFFLKPHEVASIGVNPGGDNIPNTGRPMHETLLEGTG"
FT   CDS_pept        join(1116363..1116989,1117040..1118226,1118265..1118691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950920"
FT                   /orf_name="Pc13g04660"
FT                   /product="Pc13g04660 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91535.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H237"
FT                   /transl_table=1
FT                   /translation="MASSRSTGKRLPISCQACRTRKIRCSRDGRPCQTCVRRGLGAEDC
FT                   IYLGQPRLSTEQSSPGDSVVQSELLARIRNLEALLQKQMASNAGTPNGGAVSPLGGTSA
FT                   AGSFSEPETWDSLGPMLDNVGKLHTSPSGHVRYVPLTSQWESLVAKSCAVECLPNLDSD
FT                   IAEDDDDLQIPLARNGSISRAELLSVLPPGRYCDTLKDVYLQVFSSVFHILHDLTFEAE
FT                   YQHFCHDPGSVSTSWLALLFAILAIAVSALDDDHPLLSDLGRERTVSRNIKVLSARYRS
FT                   AALRCLAADGVMSRHSINSLQALILINYARVHRGLPIWTLLGFTHHVAISMGCHLDPER
FT                   FTLGPIEREERRRVWAGLMVLYTIQNTAFGSLDQQALPQDVKMPADIDDVDLLTSPSSK
FT                   RPAPSTFPRPTQMTYLLLNFRLYRTSSKICETIFSYPSTSRFTTSHLEAEIISVREMVE
FT                   ARYAADRNNPLLIHHQANHHILYSQIHQLLLLLLRPGLCRYLQGEITPETCATRAKCIA
FT                   SAKASLSIFETLLETQSFKPYKWYTSGLGSFHAFHAAVTLAVILLIPESQSEYEEIKDI
FT                   LDRALDMFASLSVRSVFCSKAVPIIRQMILVTNAQTSDVASTKYNPQSPTHSQSHLQAQ
FT                   AQAQAQAQVQAQVQHQQNQANIQSQSHNHLVPSIQIPPSMSNLSPGMTMQDNYALSHPH
FT                   SQSGSPVPTVASTSSEHTMHSSFGQMHPQNWISPTSVPWETLGAGTGGYGFD"
FT   CDS_pept        complement(1118990..1119589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825172"
FT                   /orf_name="Pc13g04670"
FT                   /product="Pc13g04670 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP91536.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001830C55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H238"
FT                   /transl_table=1
FT                   /translation="MSSPTELRDQPKTWTKGEYLVSTDVSLIPIETLNTWYAGEEFYWA
FT                   KPMPEPTLRETLQNSLCFGLYRNPSQVRSQNQPDKTPENEASSESTLEFVGFARCITDY
FT                   TTFLFLTDVFVLSSLQGLGLGTWLVTCVQEVIESMPYLRRSLLLTGDWKRSVPFYERVM
FT                   DMELMVCNPPVNGEDAVGFAVMQRKSWGAPGFGEKP"
FT   CDS_pept        complement(1120093..1120983)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129536"
FT                   /orf_name="Pc13g04680"
FT                   /product="Pc13g04680 protein"
FT                   /protein_id="CAP91537.1"
FT                   /db_xref="UniParc:UPI0001830C56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H239"
FT                   /transl_table=1
FT                   /translation="MTTAAFKYIDRASYDPNATEPFKKPWGKVDGPGRSYQLIDLERKV
FT                   ENLRGQESDFTTDNSGFALYNSPAKETAFTDDAEVRAGYYAEVEDLLRKKLPGVKKVAI
FT                   FDHTIRRRTPGSARSPVQLVHVDQTPKAAEARVRRHLPEDEVEELLKGRYQIINVWRPI
FT                   ENPASDFPLALIDWRSIAPSDFVKVDLLYPKEWQEHGEVAPDPESISSTQGYEVKGETY
FT                   AIAPNEKHRFFYAKDMTPEEVMFIKCFDSRSHTMTEGKTDIAHGSGHTAFIDPQTPAGS
FT                   PGRQSIEVRCLVFYE"
FT   CDS_pept        join(complement(1122376..1122520),
FT                   complement(1122011..1122163),complement(1121837..1121929),
FT                   complement(1121657..1121745))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950921"
FT                   /orf_name="Pc13g04690"
FT                   /product="Putative uncharacterized protein Pc13g04690 "
FT                   /protein_id="CAP91538.1"
FT                   /db_xref="UniParc:UPI0001830D15"
FT                   /db_xref="UniProtKB/TrEMBL:B6H240"
FT                   /transl_table=1
FT                   /translation="MEFYPESIDTKSGSDQAAGSYKLTLSQGGGEQHPEMHPIGDRRIV
FT                   PIIRMLDCKRFHSVHFVPCGMPRTTTKHGVSHITTVRTKCDFHDAQHTDSIIVKVEAVI
FT                   GTNKFELDWAILLSRESDVAFGYYGSGLGVLHSMSSPLDSMRTYTRRDIKPNLIL"
FT   CDS_pept        join(1122695..1123255,1123320..1124129)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950922"
FT                   /orf_name="Pc13g04700"
FT                   /product="Pc13g04700 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP91539.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0001830D16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H241"
FT                   /transl_table=1
FT                   /translation="MKFSALLGLLTFAAAVSADIKDQQSPLSSPSIANLKSKIKNVVIL
FT                   EMENRSVDNLLGGQTIKGLDNPINNGPFCNPYNLTDPSAGTVCSSAKDFDSVLDDPDHS
FT                   VTGNNIEFYGSFVPNNAHIAQGKLTPTQHGFVHEQLRSYGDDADKAYLAKQVINYYIED
FT                   EVPVMTTLVQNYLAFNHWHSDHPGPTNPNRAFVLSGTSAGHGYNDETFNPDIHGLTHRS
FT                   IFQQLSETNHTWKNYYTSPSMVDAYFFNWTFTSGNSDKAVPLDNFYADAAAGTLPEFSF
FT                   VDPSCCGVGTNSMHPTGLVSEGEALIKDVYDAVRSSPQWEETLLILTFDETGGFHDHVP
FT                   PPLATRPDDLTYTEIAPSGEKYTFSFDRLGGRVPTLLISPWVAKGQVEQKGTNSDGKVV
FT                   SYSASSILRTLGYLWDFEPFTPRVKSSPSFEHLIHNTARTDTPVKLPVPKAFRKMEI"
FT   sig_peptide     1122695..1122748
FT                   /db_xref="UniProtKB/TrEMBL:B6H241 "
FT   mat_peptide     join(1122749..1123255,1123320..1124126)
FT                   /db_xref="UniProtKB/TrEMBL:B6H241 "
FT   CDS_pept        join(1126047..1127790,1127854..1128213,1128281..1128487,
FT                   1128563..1128786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951944"
FT                   /orf_name="Pc13g04710"
FT                   /product="Pc13g04710 protein"
FT                   /function="DNA binding"
FT                   /biological_process="spermatogenesis"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91540.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007283"
FT                   /db_xref="InterPro:IPR000221"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniParc:UPI0001830D17"
FT                   /db_xref="UniProtKB/TrEMBL:B6H242"
FT                   /transl_table=1
FT                   /translation="MSYTYRDRERDWDDTRPVTIKRYVVSPEDDRRDFMSRYDDSFGGE
FT                   RELVIRRKSDREEPVTVSRYEREVEYEPPTRYERDHYDREYLHPTYRPHSRSMDSLERM
FT                   EQSPTATAIATRKQSVLIREARNPYISPRESDYDVVRRSEADEDPYYYHRHRRLREYDE
FT                   HRSRRELSPDDSVSQTSRRRRGDRDHDYSSDDSMVYIRKETRDYDDHPHHRRHMAEGAL
FT                   VGAGAAELLRSRSKKDGEVSHGASRIGKTLGAGALGAVAVNAASHARDYYHRSKSRHRS
FT                   HSFEDDRASHRHSRHGRSRHSRSRSRSHSHSRTKTLLEVGVGAAALAAGVAALRSKSKG
FT                   GDRKSRSRTRSRSRAASRGRSEKDGEHGERSMSERRKHMAGAGLAGAAVAGLVEKVRSH
FT                   SRSRKGERSRSRSRVRQALPIVGAGLATAAATGLYEKQKSDKDEKDGSSRGRHRSRSRS
FT                   RAPSQSYPDPARDSAGLIEYGNDPVTGSIPSEHYYGQPGAPYYEAQEAYGPRRHSRSRS
FT                   RSRSRARYTSSSDSDREGRRRRSKKHRSRSRDLAGAALGATGLGYAAHKYNERRKSKER
FT                   EREHSKHDDVHRDPYEESYDPEPYPPSPQRAPGAPPMADPHYYPNSNYFPPPPGDSTYN
FT                   LGGGTPVSYNPADYPPPPGAAPPQPYAYGAVPPGGPGPDQYAPRPRRAEDNVSSSTLPT
FT                   DANHVHKGLNIHPFPTSPPRSSSQPPQVSKSVAFDLTELPRDPGYETDESDSTVEPYSS
FT                   LHRGGRTHRRDRDRDREHYYSSHPASSHHRHHPSASKSQEGRDQNKVSETDSDSTIDLP
FT                   NRFDGQGRLLPERDPAVDKFEDLVNRFTKVLF"
FT   CDS_pept        complement(1129952..1132675)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951945"
FT                   /orf_name="Pc13g04720"
FT                   /product="Pc13g04720 protein"
FT                   /protein_id="CAP91541.1"
FT                   /db_xref="UniParc:UPI0001830D18"
FT                   /db_xref="UniProtKB/TrEMBL:B6H243"
FT                   /transl_table=1
FT                   /translation="MAAESERPPHLNGTPGRSSGPKGAEAPSDPTHRSASESGMMERSL
FT                   VTPQTQPMSQVPKLFPTPPSASASASTTNSAVSSREPSPVRHSSRTYTPTYNPSSPTRV
FT                   SSQSRKTSQDRSSPIRHSNGLTSGPPTSSPTPNLQRSSSSPVRSLGLSVPVDSPANVPG
FT                   PEKSNMPSWAANRRTDLDSTLPNTSQKRSSLPLEDFTPKPDRNTTRTVARGVSGQGSSL
FT                   ETVEEMASNPSTPSSETPTKPVIPEESRLHRIDEDPTPRAPHQTLGSGSDSGENRSSEP
FT                   KEETRPQAPSAAKTTKTLMSQRSTTSLSASARGKPADGSVRNMIVETETVSSIPQVSMG
FT                   VGNGERGNASRAEQGTLRMKPSNETIRPRKEKKKNRRPNALLTTGPVTSKADIFEARVA
FT                   NAVDEADVSDSDETFVYDSNPPDPYPSRPPRYHSRTPSATSMASQAEQLAGRTRGLRDT
FT                   SHGVTGKRSMKFTNTNPYNNGSIEGDGVEIDMASRSTRPDGSGTITPRHHNLGRLHGRN
FT                   GMHPNLFDNDSAHSQSQSQKSPRHFIGNSYRHSRHRLSPNYRTIGGSKKSGEYDYEAEG
FT                   ADDERTPLVGTPRTMHSRGGRRPNSASLRQMQYMAQRERGVFARFGSCAIIFLLLLIVA
FT                   GGATSFIVAATQPLLDVQVIAIQNVLASEQEIMLDLNVQAINPNLFPVTIDDTDVNIFA
FT                   KSRYVGTDKFWREHGDLDNFPRVEQSRRRWQLSQAVRCLGNMDCVKEAMSSQPDPHTTD
FT                   GVDKGTDPPTDPEGDPRSMLLGRVFHFDSPLSFESSPWNHLTSSSKGQIRLPRPGNKTE
FT                   AGGTERWERVLQHPFELTVRGIIKYQLPLSSRYLSASVSSSIKVVPDTDDNDPEQTPPS
FT                   NDTVRISVPQRSAPPIRLPLDTRSTGSGDSRRPFTA"
FT   CDS_pept        join(complement(1134388..1134430),
FT                   complement(1133616..1134346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978593"
FT                   /orf_name="Pc13g04730"
FT                   /product="Pc13g04730 protein"
FT                   /protein_id="CAP91542.1"
FT                   /db_xref="UniParc:UPI0001830D19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H244"
FT                   /transl_table=1
FT                   /translation="MTMVAWRVYLFQSGDLESGRRERETDYMLFHIDPVDFTHDFLDEA
FT                   TAYFPRLRLSFDIPHKLLLITIPSPEHAAAIGALSEETRRDLDSMGHGLSHAIKSYPGG
FT                   GTRAQNGKGKDADIAFGPRRRAVGERANGNEKRYTVVAEIAISETETKLKRDTDFWLDP
FT                   LCGNANLVITITASRKLAYIKIDTWQRVNDQAHCTGSLSITKTTQGRVKVTGPLRIPFD
FT                   ALFDRAPTSPAERAISLSVQRLQSLAEAIWEDQGI"
FT   CDS_pept        join(complement(1136079..1136762),
FT                   complement(1135956..1136030),complement(1135556..1135900))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672737"
FT                   /orf_name="Pc13g04740"
FT                   /product="Putative uncharacterized protein Pc13g04740 "
FT                   /protein_id="CAP91543.1"
FT                   /db_xref="UniParc:UPI0001830D1A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C3"
FT                   /transl_table=1
FT                   /translation="MDAAEEYAELMNVNKNEGKYLFYPQRFSRLHPGSVGFFNRHGVWS
FT                   EITDLCEEGRPKRDGYENPSRPLKLDQPTESFWKTRSSGSEAEMNFGLTGGLSGALSAA
FT                   PVDVSAEAKNKSGSSGQAALITESAVRHETLEAPFQGPIQKWVEKNAKALVDSDYGEDV
FT                   ATYGLWAIQAAWVTKECAITLNSAKNREANLGFDVGATGLGKVGASGGSLAKLEQKGWT
FT                   AYEAKEGDQGLVIAFGGFKYELHKFFKWRSNPLKITDTRMDERPETIQVTPLFTKPILD
FT                   ENGVETGFEIFKHILNENGEKIGEEKVDIGVQGKEGEGNERRDAEREKEEQERQEKPEE
FT                   KEDSMIQCDTVGISETALEADSKAKQA"
FT   CDS_pept        join(complement(1140390..1140868),
FT                   complement(1138261..1140321),complement(1137982..1138184),
FT                   complement(1137862..1137932))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951946"
FT                   /orf_name="Pc13g04750"
FT                   /product="Pc13g04750 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91544.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001830D1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C4"
FT                   /transl_table=1
FT                   /translation="MDPPMIPIPGTASSRPPRSSHSSSPRKRPQHSDYPPADNNASHGL
FT                   MSGGRAPGTGPVPVPETSPANKTRSNPPADNAAGKPSKSSKRKKNRNRKRRNRHQSFIP
FT                   PSREESHDSPTEISDAGGVRDSMEADRPTSRDKSFFKLGRNLSNTSLESDALLDHRDQP
FT                   SMRPRRDSRLASSFRPSSLTSNVFRSNDGQSRNTPRGTRSQQHNGDSDEEDTNDRTPLM
FT                   RPVSGQIPGHNRYGTDTRPGLFSSRARHPSAQTISSECSPKDDRSPLYSPCVDRDYDVN
FT                   NPPSIPGSPKLGPEMNYEDAVVTGADWDFSMARSLDNRKDSLNPLNDTLIDIEGNGSHP
FT                   HSAPSSSPGSPLLSPHQELRRRRTVAVPAEEDVCFPTEAISELGDEGPRQMRDEVGERR
FT                   RRRHRRWPDLSVLEEWSREEKEERNGDIRVKRISEPVLVEGRLRPQYTGWRREEDEAPY
FT                   RFTYFNEEFPSTIHAQTISELVQPGGSFRDLFIPDPPELEDSSEDEDDEDESFVENPAF
FT                   NNSTQAPNKPTYHSDNQSQGQGHQTNVNPHMTTQTVAPNGRSTSDLMTGNAPPVRGPSR
FT                   LSVISEGRPDSHRELSPAPSNTPFNNTPNTKPKRYGPRPTFWLDVLSPTDGEMRTIAKA
FT                   FGIHALTAEDIMMQEAREKVELFRSYYFVNYRTFEQDVNSEDYLEPVNMYVVVFREGVI
FT                   SFHFSQTPHPANVRRRIRQLMDYLILSSDWISYALIDDITDVFGPLIQAIEDEVDEIDE
FT                   MIMQMHSSSKEVSSNDSVLPSFAPGEMLRRVGECRKKVMGLYRLLSNKADVVKGFAKRC
FT                   NEQWEVAPKSEIGLYLGDIQDHIMTMTGNLTHYETILSRAHSNYLAQINILMNERQEHT
FT                   ADVLGKLTVLGTIVLPMNIICGMWGMNVKVPGQDIDSLTWFWCITAGLCVFAFVSVWTA
FT                   KRVYKIV"
FT   CDS_pept        join(1141701..1141788,1141865..1142616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000059368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951947"
FT                   /orf_name="Pc13g04760"
FT                   /product="Pc13g04760 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91545.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830D1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C5"
FT                   /transl_table=1
FT                   /translation="MAPPTCRSEILAHLRRQIEDGKPIVGAGAGIGLSAKSVEAGGADL
FT                   VIIYNSGRFRMAGCGSLAGLMPYSNANEVVVEMAAEVIPIVQNIPVIAGVCGTDPFKHI
FT                   PRFLKQLRDLGFAGVQNFPTVGLIDGNFRANLEETGMGYGKEVEMVRQAAELDILTTPY
FT                   VFNVEEAEAMTKAGADILVAHMGLTTSGLIGAKTGKTLDQCVVEIQAMRDAAVQINKDV
FT                   IVLCHGGPIAAPEDAKFVLDRVQGLHGFYGASSMERLPVEVAIRDTTAEFKKIALKR"
FT   CDS_pept        join(complement(1143862..1143952),
FT                   complement(1143664..1143817),complement(1143369..1143455),
FT                   complement(1143263..1143312),complement(1143141..1143206),
FT                   complement(1142885..1143063))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129808"
FT                   /orf_name="Pc13g04770"
FT                   /product="Putative uncharacterized protein Pc13g04770 "
FT                   /protein_id="CAP91546.1"
FT                   /db_xref="UniParc:UPI0001830D1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C6"
FT                   /transl_table=1
FT                   /translation="MDHDAYTASHHVLGLAKYANDSYCTLHLTAVRACWRRLLSETDPR
FT                   RTLDLEQNTDGQEHELDGLAMVISKTNYKPLSNRRLGPISIPSKFLLDSVDSYRIVNRA
FT                   DPPSPLNSGDGIVQNDVNVMLVEWGRVSGTAELYMCDRNGMPNGQRPIVPRSLGLPNKE
FT                   SSRMSVIILSLPPPKAYNADNSRRAGRSPDLPTTGVCHRRFGKIR"
FT   CDS_pept        complement(1144707..1146188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951948"
FT                   /orf_name="Pc13g04780"
FT                   /product="Pc13g04780 protein"
FT                   /protein_id="CAP91547.1"
FT                   /db_xref="UniParc:UPI0001830D1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C7"
FT                   /transl_table=1
FT                   /translation="MQHLQDIETRLDQLISENRLLIAARDEAEDKLRNTTVARRKSDRA
FT                   LNTRDGDLRDRESEVEQLKNSVEWLQKEISRLTQENEGLTASNSALAAAHAAEVNSVRE
FT                   SSTRELADLQSQHNQLSSQIEDRVRQEIESALAQKDIELRRLRTELEEARDKVKELQQQ
FT                   IAASVHDNALVFRDEEYFDAACQKLCGHVQSWVVRFSKHNDKRRCRPLSELQDEKIADR
FT                   FDNALLDGSDPDAYLSDRVRRRDVFMSVVMTMVWEYIFTRYLFGMDREQRQKLKSLEKQ
FT                   LGEVGPARAVHRWRATTLTLLSRRPAFAAQRESDTEAVTLEIFQTLSRILPPPSHVESQ
FT                   LLDNLRKIMRVAVNLSLEMRTQLAEFIMLPPLQPEYDTNGDLARQVYFNAALMNERSGL
FT                   TNDNGELEAQQSIVRIVLFPLVVKKGNDVGEGDDEVVVCPAQVLVARPSKDKKVSRMMS
FT                   GDRMSIDPTRSVHSIVQSITHSVAPSSMMDMSNVI"
FT   CDS_pept        join(complement(1157781..1157834),
FT                   complement(1150344..1157748),complement(1148703..1150172),
FT                   complement(1146334..1148429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825424"
FT                   /orf_name="Pc13g04790"
FT                   /product="Pc13g04790 protein"
FT                   /protein_id="CAP91548.1"
FT                   /db_xref="UniParc:UPI0001830DD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C8"
FT                   /transl_table=1
FT                   /translation="MVLLHGFQHPRLAQLLLQRPRSQSTSPPATEKTLDLTPKSLSRPA
FT                   SPETSHPQGSRSPKQRRHSVAKSTTESPTAVPLHFRRPPTSPGLSRAVPVEQPAPIASP
FT                   GSPSQQRNRRPGSVEFRNSREIRPLWLVERHSLTKGEPETEEPLPSLPSSKTSSRVPSI
FT                   EDLKSLRDDDGLKSWEHVDLSHSITGNQRPTGLTISTEQANESHSGDVDLLGSQQATPT
FT                   AEHFQDAESRKERPRYEFHSPSELLRDPTALDELPPSPTLDALPSAEGSLVGVGSREQE
FT                   TQRALDALEGVSRPQSESETPTQDNNSLSSAAAEFAKGAGFAGVVDAVAIAAAREHDQS
FT                   RALPGDELAKPRSFGDIVDAAVAADGSSHDHDKAPVHEEALSEPVTAIEETAPAPLEPV
FT                   HPEMETAKESVPESTEQPVQSSDRQAQPETEVAPDESAQSSKKKNKKKKGKKNQAQDVE
FT                   LGGPEEPLAQEELSKEPVEEPAMDTPTVETVSAEPEVSVPEQSEPVEASRELGPGTGAD
FT                   EPVVEGAPVESAPVESAPIEPEVANPEQLEAEPIEASREVEIEPSVEAAQEPGVVTAPE
FT                   AESTEVPPAETELAEDAASSTKKAKRDKKKQKKKSKNESTSEEPTDDNVVAQPQDDTSA
FT                   SKEIEGQQEDSAHAPSEEIVATPLPEEMVTSTESTESTPDQTATSSAAIDAEQARSHPE
FT                   SGELVEPVEQVSTEEPVLPVSEGPSVPIELTPEPAFTDANETPITSATQPEAEEVSRSL
FT                   EQIEKPSEESTPEAPLDNTTPEITETPKEDTEGEDNFEEAVEEQIPQPAEEKEPPVEEP
FT                   PVEVATDAPAEASETKAEKRKNKKKKNRKSTAVEETDISTEMPAPETELPPERKEPEPE
FT                   QSAVVEPADTQSLPIGGEALPSDPEHLEQPTKDVDQPIETTIEESAATQEQEQAPLEAA
FT                   VDATPAVTEPVDPAGPSDELSQPAVVEVQPDAKLPAEEASREIPEPSAVETQPEAEVQA
FT                   EPQPEVAAEPEVALTAAQKKKAKKNKKKGKQSDSSIPDEKPAESTSPAPEAETAAEEIA
FT                   KETLLATEDTPVVAPPQESEMEVPVKVEQSIEPEQLPETEQIPEDLPALDEASPEPLPE
FT                   PMAEVTETQTTKEESNAPGEEPKAEESPAEPEVPMTAAERKRAKKAKKKQQKEQEESIG
FT                   SIAEDTKPVETVPAPDAESAEPSKDIAPAAEIDNVAPADSSAPVSSEPAETEQDVAPTS
FT                   TTEPEAAPVTEDTPLPTDPESIEPTKGIEAPAKAEPPVKDAAPSPEIGATEVAADVPLV
FT                   SEEAAAPVDVPQDLDQHNDVVKAEEPKSEDLTPAPTQEASADAPETDAPKAQEQSPEPE
FT                   VLMTAAERKKAKKNKKKQQKQEAVQLDEQPTREAEPTSAEEKSVEQSGDMLPESEPTPT
FT                   AETAAGVDDPTEPEAASDLEAETKPEEEQLQDVAKLDSEVVPGAPADEAISTPETAEQA
FT                   IDVQDGNKETAPEPTVEVPASTEDPQEAQKLDSAISEELALEKSLDDKPTESTSEPVAE
FT                   ETQPTESASPVVEQVEDEQAATSSKSKKKNKKKKRQSVAADEEQPAPAEEEVKPAPTEE
FT                   EPTPVPAENEPTEPAPSQELEQPSSGKDADTPMVTEEAPKAGEPVMDETTQPEAPADTA
FT                   ATEAAAEAAMTPAQKRKAKKDKKKRQSVAVQEEQPAAAEEESKAAPVGEEVKAAPEEEP
FT                   TPVPAENKHTESSSQDLEQPSPEKDAETPIVMEEAPKAEETTQPEAPADAAATETVEEA
FT                   AMTPAQKKKAKKDKKKRQSVIAEQEQPASVDEPKPELAEEKATPTPAEEDPTPESGQEE
FT                   LVEPTPTQEIEQSAVEKDVESPIMTEEAPKAEEIMQPEAPANAAATEALEEAAMTPAQK
FT                   KKAKKDKKKRQSVIAEEEQPASVDEPKPESAQEEPAKAESTRDTEHSTVDKDAQAPVMA
FT                   EEAPKAEEPSPEEATQPEGPADAAATEAAVETPAEEAMTPAQKRKAKKDKKKRQSVITE
FT                   EEQPTPVEEPTPESVQEKPTEPESTQEIEQPTLDEAAQTPIITEEEAPKVEEPSLENVT
FT                   PQDAPADAAATEPATEETMTPAQKKKAKKDKKKQQKSVAFDENATLTEDPKPEQDTSTP
FT                   EEKVESRDAPADLIVSEESAKELPVTEEAAEPAPEADISETREEPASSEESKDTTEHEP
FT                   TSTTAPDTPVPSEVKEPESAAALPEHPEQDAQTPPEFQNPSAQEPEVALTAAQRKKAKK
FT                   NKKKGKSVDLADNAPSATDAVQESEPKSEPVVQTSTDTPAETPELQDTPASELALPAEG
FT                   LEQDNTIEPEAPKAEEHETTEAVSDDVTKEETPEAKKTDNEPPATETILDAEPAPSQEV
FT                   EAVASSPTEPTEEAGMSAKERRKAAKKAKKRQSKNVDADTDAATSDPPSAPATEPTAPI
FT                   EAADSVEKVLTSTDTDAPGLSAVPASSPAEHDGKEHQSHGIETYDATAQDTTSTDKDMS
FT                   SQVEQTPIESPFLDYPPQPVLERDLSTEKEIEEMPVDVPIDVVPEAQIQESPVEEKASE
FT                   AAVSKKHKKKNKNKNKDIKQEEEAAVPEPASSTAEDKEQSEAGPSVEAEIQPEVKEIIE
FT                   PEPIAVAESVPIPEEQQPDQLQDIEETAAVQTTEDVDDTKEINVPEAEAAAPPTEDTTQ
FT                   PEAPVDVADIEATEDASMTPAQKRKAKKDKKKQRQSIIAQEPEAEAQPEEKTAPEAAET
FT                   SAQEAGITTEAAPGEIVTQDEAVPSAEEPTAQPIDAIQEAAKDPVTPSEDTEQHVLSQE
FT                   IENGERSLELPSTESKVEEGDKPTEQAAAAPAENPDDEQSSKKGLPEAGPEPEGESATV
FT                   PKKMSKKEKKKAAAAAAAAALVKEEKLAESQPEPKEALVSTPQAPEEVVDQSMVQEPQS
FT                   SETEDKPPPEAEKNPDEITGLPASRLKEDVLEQPAEALDSTEPLESEVKLEESTKELAE
FT                   EPAAAETITRKMSKKDKKRAKKQAQEEIIEPTSPPTEDHAQSEKNEAVISLGTLDTPSP
FT                   VEPTDQNTNNEPLDLERPAEKNDKKDEALVVADSQNLENAAVDQPVQPEVMPAMSKKMS
FT                   KKDKRKVKKNAGITEEVLAQQQEPQADVAELPTESEVQPAEPAAEKEIHQEPEHSAEAQ
FT                   PSLERELPIETPASIENEPIPDPGVQVKPTQPDEEPVVSEEVPLSRKASKKKAKKAQKA
FT                   NKSLDAEALAENTIADHHTTIVPFEEDQSKAEGLEVPDEKSAQDEEDWPAIDWQAKFEE
FT                   SQRSREADPEPEPDIPAPEPEIIGEFVDSSFREVSQDANEATEEDAWALPTSKKDKKKA
FT                   KKNKKQSQQTPPEAEGPSLEPFNDIEIEPPARTTTPGGSKIANLFPGLERGGFRRSALD
FT                   QQPRSLKDSAEEETTADLEANRDVAIPVLEAPPATTETKEIPRDFTSELPSSLERQIES
FT                   TISELKAHSETPTATEHGSIREPELPPEGDKSKDMPSSLSMEPSDERTRPTEPSSPTRL
FT                   PPREEAGKELCELRRSPSIHGRHQHTPRTWSLEEPSLPALRAPSPPRSLFGGPTDDYVR
FT                   PRTPLDTIAEQEPRDGQGATMARRGTPRLEMKPEHVLPRPQTPVRKFTDNAFDREAWPK
FT                   ENKKGEGFKPEILKTPEQGMPILKPSTSSGKLRRTNRSISGDLRAASRALDSQPSNLDL
FT                   DQLPSSSSYDPVTDKGKRPLRNMSDVYVSH"
FT   CDS_pept        join(complement(1159296..1163983),
FT                   complement(1158083..1158734))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951949"
FT                   /orf_name="Pc13g04800"
FT                   /product="Pc13g04800 protein"
FT                   /protein_id="CAP91549.1"
FT                   /db_xref="UniParc:UPI0001830DDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C9"
FT                   /transl_table=1
FT                   /translation="MFKALMGGGRSSSSDVRSSKSSRRKSEKHDKSDTRSISSRKFSRG
FT                   DDRDRGLGDLSSYPPSTSRSKRGPPSIAGESIASTYVTAEPEAIDESDRYYIERTPKRR
FT                   DSERESKSSRRHDQDRSESPEREKRRSRRGTQDTLDDDLDRESDRRERRRTHSGDPYVP
FT                   PISTNMPPSAPGAQFAAEIGAPGFSQFPMQYDAGMPPAGHSPAHEVPYDPHVQQQFPGQ
FT                   FPEQVAAPYPPPNPAGAAADYYGDQGQSVEHQPGIRPARPSVLPNTQAHLMAASPSANP
FT                   PPEPSSLGETGAAAAYFDDNFHAPAPQDQPPEVRPPKPSKPSKPSSSGVLPAAAVGAAA
FT                   HGIGGMVSHSESHSPPQHTTSYTQQGQPTVHDQPMVHHEPMEYDQPMASSSHKPPSKPP
FT                   HSHSFSEGVGIAAAGAATGYMMGHHHHSSSPEHAPQYAFEHHGQSSQVGGMLPYAPVHN
FT                   NALYAAGAGGYAAHAAHNPGFYPHGPSALAFQERQRGAMERFVDFWRDPEAVGRFEDYT
FT                   ETIGVCKYCFQPGTSSADAPRKHHYYRRRRHSPDRRSSGSSRVSKTSRYNSSDDEGRRR
FT                   SKSKKSSSWLPGVLAGYTAKSLFSSKAFDDSYSLRSGRVASHHGEEDDRRSRTSRGVAR
FT                   RSSRSPHRDYHTGSTHASQSGYSRHSRSRSRSSSRSGRPSCLKEAALGAAVGGAALAVA
FT                   KSRNPSRSRSPERRQYRKDSSSSSSFVNLPRPGKKSIAGGIGSFFTASSENKKKRHTKK
FT                   RSGFFSFKSGSSSSSLDNDLAFGDGFSRKPSKLKKKGKKGKDVDTALLELSDTATRLAG
FT                   SSPHGPGRSAGQMYKARSRQSNYSTTNDEWVDAESEDQSSSSVSSALAFGGSSVDSSSD
FT                   SASSKWGWRWGSKKDKKKKDKRSSATNAALVAGAGAIGAAAISSARDHDNNPPSRSGSL
FT                   QHVYPMPTSDPSRFDVAKMSPSVSAGEPTLIRPGPIPLQQPQPFTPVSQSVYTTQGAVP
FT                   GSIPVYSAPAVPPLFANGVEHFESQFQGPRGAAWAPESTYAERRKAPRRSDSSPVFPTQ
FT                   ETASSLKRRYTSKDQASVQFDLTEEQAERERHLTRRDKNYRGEFSDQPVQLIDREEELA
FT                   RHETERREHRRKERDDEEHRYAGDRGKHSSSWVGVAAAGAVGTAAASTILSRKTDDDEA
FT                   SEASQRYNERREKRRAERKRTEAVAVTSVVSRFEPTQPIDEEVTTAEHHEDQKKGSPRS
FT                   PRPPQVYDDYAEFYAPEELRHSPDDHARSRRSTDMPTIVEVEPASERRTHEEPAPTEVD
FT                   YSYEPYQHVDRLPWPVPALNFIEPTPPQSVNGGSVRDATSPTAPVNKSYDTKPRERPTG
FT                   SRVSWGEHETHEYEIPSSSEQDPFEHDISPAEISAKDVPLPASEITQSKDIPSTSQYGA
FT                   DIEFAATIAAATAAAGFDPSLITDDPSYHTRTSPPGSEGEHTFTSPWSASARNEPRGFV
FT                   EGELEEIDPKSTKDITSAPEHVSQDKDELFFDEPESFSRDRDISSGRRDKSSIAHEVIE
FT                   QLNGKYGKRDRTASPEKDVDVFSMPGGFDTAEPRDLADARSVAGYDFDPRLDAEAAPDD
FT                   VEGGEEKKRRRKRRSKHESDTFSVDDDARSAITDIGDEKSERRKHRHRSSRETDVDDNA
FT                   SITSSPARIDESREKRRGKDEKEKSGGFLRGIFGSQVSAPAERVRSDHSRSSSLDKRSS
FT                   REAISEIGVDDERRRHKRRSSKHRSSSNGDELDRYMSDKEKGTQDDTNLEEYRSSRQQK
FT                   EERRRHRYEEIVDSGRNRESEKV"
FT   CDS_pept        join(complement(1165818..1165854),
FT                   complement(1164752..1165761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672738"
FT                   /orf_name="Pc13g04810"
FT                   /product="Pc13g04810 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91550.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001830DDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D0"
FT                   /transl_table=1
FT                   /translation="MTPNARKWPSREGFTADVLGKFISRSLLDPWKLVPIVALAQYTAQ
FT                   GRDIAKARPNLEKALKALTALALINRLGNWLDRRTLNNSTSDPYDWNREVVILTGGSNG
FT                   IGRRIAELLGARDIKVAILDIAPPATDDVLPNSVRCYECDITSATDIADVASKIRSSFG
FT                   RPSILINNAGICTGKTILKTTPAQTRRMFEVNTLAHYWLAQEFLPDMIEANHGMVVTVA
FT                   SLAGYTVTPNMVDYSATKAAAIAFHEGLAAELVTRYHAPKVRTVLVTQGFTRTNLIKDL
FT                   TPEDTWLNPLLHPETVAEELVRQVLKAESGHVVIPGSAGWIARRFRGQPEWLQHLLRCR
FT                   LEKLMRAD"
FT   CDS_pept        join(complement(1167392..1169445),
FT                   complement(1167006..1167321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951950"
FT                   /orf_name="Pc13g04820"
FT                   /product="Pc13g04820 protein"
FT                   /protein_id="CAP91551.1"
FT                   /db_xref="UniParc:UPI0001830DDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D1"
FT                   /transl_table=1
FT                   /translation="MPRTQVSPNVFDPGSQDLGASKFGQKLPPMDPRLDQKEAEGELSI
FT                   PVEHTTAAHKLLMWPSIKRLLHPAHYDEDYVMRLEEERGLISIYGQGEISYTADDSQLP
FT                   MDGDSRGARPDVNGAGPDANVDIDEFGNLNLDAATARRYYDSYLEHMFKLHPFLMEGEL
FT                   NIKVDSFIRSYCRLNNSPPSSSSGYSRPARDGPPPAKRRRSNENLGVRGEYMETIPNPL
FT                   RPRVGKNIDNALVLLCLALGAICEAPTPLPGPIMDKKIDYLNQPIPAPLPPLTPPQPAN
FT                   TTYVTNANGVLSPANSDSAAMQMSFSNSLYSVPTQPAGQAFPNSPFTKGIEGLSRRDVT
FT                   NTRDEQGNTKNYQVIPGLTLYGYATTILGHLQGGNELEHVQCGLLAGLYAGQLAHPFQS
FT                   HSWISQASRACQVLVRTKRYERLEEGATQDLYNFAYWTCLQLESDLLAELDIPASGISR
FT                   SEGRMAIPKGKWTIVLPNDLTAPETMMMLFYSAQIHLRKLLNRVHTDLYKVEKQGQTRW
FT                   SSTVQEALSLNLDLWRNSLPHSMQWSENDPPADEINAARMRAKYYGARYIIHRPLLYHA
FT                   LHYGYTGARVGPIGKSLVDSPTSQQLSPSMMHSAGRAPSMARMSSEMGSMPAALSTDWQ
FT                   PPKVRLHELPKKLKTACDICIRSAIKSTEAFDGVGGHRLVVTNIFGTAHAQFGNMLVLS
FT                   ATYMSSLKELVDQDQLDRLLVRTIGFLIQSENISPTLRADARILTEIYKKIFGRAPDLR
FT                   RATKVSSQTPSMNSQTPSLSSQTPSLSSHTTSMSFP"
FT   CDS_pept        complement(1169856..1170416)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825425"
FT                   /orf_name="Pc13g04830"
FT                   /product="Pc13g04830 protein"
FT                   /protein_id="CAP91552.1"
FT                   /db_xref="UniParc:UPI0001830DDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D2"
FT                   /transl_table=1
FT                   /translation="MNRMPPPEAHHTHAGPHTAYDPSWRPPYPPAFDNHPSDSRRSSAN
FT                   SQTALPPQPPGYPVMPNRELPQLTPEGPYGRPNGHGLPLHAPVHSPQDPIPTHPNFHQP
FT                   MNGAPHEGSPDYRARMGYPPPDQISSAEHTPVSGALPPASQFMTPVAQMANVTPPAGYD
FT                   QAFYQNQTFGARQRKANRATQVC"
FT   CDS_pept        join(complement(1176819..1176922),
FT                   complement(1176604..1176633),complement(1176330..1176440),
FT                   complement(1176250..1176276),complement(1176049..1176204),
FT                   complement(1175927..1176001),complement(1175750..1175827),
FT                   complement(1175576..1175661),complement(1174811..1174885),
FT                   complement(1174432..1174712))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951951"
FT                   /orf_name="Pc13g04840"
FT                   /product="Putative uncharacterized protein Pc13g04840 "
FT                   /protein_id="CAP91553.1"
FT                   /db_xref="UniParc:UPI0001830EAE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D3"
FT                   /transl_table=1
FT                   /translation="MGTSTSTVCTAMWRVRIEDIRGPRGPSQPIRLGIILESMQVASSS
FT                   WCDSKTSDSTTGRIVAFEILVLHGKVHSRAKRLSAACTQCPIRSISSKSSRTLLSCRKG
FT                   LKVSRDQNTGWNLDFLDFCRMVASDCRSTDRDQGAGLVHGSCELGLEFKPQVFVLDSYS
FT                   RDDAAQVNCDEIKAVRGEEGAEGSESSPGSKQVRSDLDVSVAQITVATGHPKPREISTN
FT                   GWGCGCNLVMDCVFDACQHSLFSAGGIPMYLVSPLSGHWRCKLHPVYCLHTYANCTSES
FT                   QSNARNLTYSTTTMQPSVLPLLDTPYMWGFFPREKIVCVFPIWSLSNSLVKVMLSADWM
FT                   "
FT   CDS_pept        join(complement(1178233..1178300),
FT                   complement(1177997..1178161),complement(1177664..1177776),
FT                   complement(1177418..1177527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978594"
FT                   /orf_name="Pc13g04850"
FT                   /product="Putative uncharacterized protein Pc13g04850 "
FT                   /protein_id="CAP91554.1"
FT                   /db_xref="UniParc:UPI0001830EAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B9"
FT                   /transl_table=1
FT                   /translation="MEGDTYLGKYVPGAFSAVYNISGQTEYFQCTTLYGVSRGDGEKDH
FT                   DCAWSFERKSWSFHPALVYSVSPSFPIPPKRDVEYTMRPCFPKTALVSKYTNVSYAESV
FT                   TAPTFPSRNFPGLGLGVVRSELVGCFGKRKISTYQQKKQEYAEGFIY"
FT   CDS_pept        join(complement(1181429..1181453),
FT                   complement(1179735..1181182),complement(1179353..1179643))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825426"
FT                   /orf_name="Pc13g04860"
FT                   /product="Pc13g04860 protein"
FT                   /protein_id="CAP91555.1"
FT                   /db_xref="UniParc:UPI0001830EB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C0"
FT                   /transl_table=1
FT                   /translation="MFGWGSGLALPSATSEPEKERRPPADPTPLDFPVYNLSSVLENES
FT                   ESRLKEMAELLAEIKRPQDICAERFKPLNLKLETGVEVAQMIPEDNSHPVAPLPWEDTT
FT                   EPTEDNPRPLMDNGLPYPSKERYEVLEKELALDNDDAFREVARLPPREGRSRVRITQSR
FT                   KFWTGLERMAQYWDTSLDHYYERPATPDPTPPSEMDRTEDGTMQTDAGDSAAGHSLTDD
FT                   AMDVDNAQTDAPSSNGIVGEEQRPSVPLYTGRRIGNGAEMPDELRDETIRAFVEMAAWP
FT                   FGCQVTVPTLQPRLTTKNLLFPVRQTFQSSRSPRDRQIARSGMLEGPVLISQCRPETSF
FT                   RTADNAPGTGIGDVSDLFREVGGMLLAAQERAREGAVEKRPGEGKWWTMQPRFGGAPND
FT                   GILDDLVNHGHGMSLPDSMMEESTPSAQEAENASKRHKFEHPFVTSLSRRPSAMRRLTT
FT                   SEKWKILQPGPSLWDKRMSYLQIGKVQESPFDDIYMISSINHHVSILHLRVHRRYLDIL
FT                   TYGDSTFPATEGEPWHVLKLQRTRWFDLLDTNDRIEALKGVWQLFHHQLRQTRHEGDVP
FT                   VPIELPLERPL"
FT   mat_peptide     join(complement(1179735..1181162),
FT                   complement(1179356..1179643))
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C0 "
FT   sig_peptide     join(complement(1181429..1181453),
FT                   complement(1181163..1181182))
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C0 "
FT   CDS_pept        1182936..1184210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672739"
FT                   /orf_name="Pc13g04870"
FT                   /product="Putative uncharacterized protein Pc13g04870 "
FT                   /protein_id="CAP91556.1"
FT                   /db_xref="UniParc:UPI0001830EB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C1"
FT                   /transl_table=1
FT                   /translation="MPSTFSAIDTPSTPLNFIGTWSTGSSNLVTVTSIETETIYPTWIY
FT                   TISGSGPDSSTTTTVLNLSSSTLNPTQVTVTQTTKLSTTEQETIISSSSSTSTVISESP
FT                   MSPVILTTSVLSGQMGDLPFSATAKSSDHSWYSDAPSSIWTLPIPLIPSTSASVPLSSS
FT                   LPVLPETATSSVSHMSSISTPASSIIAATETPTISPSIGTVTSESSSEPSQADNPSPTS
FT                   SKIGMIVGSIIGGSAVTIFALLACALYMRRRRRKNAAERQGIRQKLIRGDSTSSSISHH
FT                   RHHSYPSIPGNISLRSPILPFIPLQQQPSNPDLSLDSMYLRGETRAQDPFADPPSTVIE
FT                   ISAPTRSASLYSTSSLGAGVGARGYWDCEREGANALAVPNEYSDTPVMRDSMRSDPFDL
FT                   DLEPPPSAHHRSSVPSISSTWGVKF"
FT   CDS_pept        join(complement(1185988..>1186285),
FT                   complement(1185728..1185878),complement(1185451..1185594))
FT                   /codon_start=3
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15951952"
FT                   /orf_name="Pc13g04880"
FT                   /product="Pc13g04880 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91557.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniParc:UPI0001830EB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C2"
FT                   /transl_table=1
FT                   /translation="ADRVFHHHRVNLTTQKRLAASVVGCGKRKIWLDPNEMSEISNANS
FT                   RQTIRKLVSDGLIIRKPVTMHSRASARELNEARRNGRHRGLGKRKGTKDARMPSQVLWM
FT                   RRMRVLRRLLVRYRAAGKIDKHLYHELYHLSKGNTFKHKRALVEHIQKAKAERARDRVL
FT                   KEEMDAKRAKNKALRERRLERKEAKRDALINEE"
FT   CDS_pept        join(complement(1195071..1195146),
FT                   complement(1192295..1195057),complement(1188403..1192227),
FT                   complement(1188158..1188349),complement(1187942..1188097),
FT                   complement(1187806..1187887),complement(1187607..1187748),
FT                   complement(1186997..1187551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825427"
FT                   /orf_name="Pc13g04890"
FT                   /product="Pc13g04890 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91558.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="UniParc:UPI0001830EB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G6"
FT                   /transl_table=1
FT                   /translation="MPPLSPPRPQCDRRNKIPHAKIANRGLASSFAFVLLEWCCILLQQ
FT                   ASEDQNTPLPTVLDLIAVDAKALENCLSHNPKPAVKQSALRVTRRALRAVFTSEAWGAD
FT                   AVRQSVSRLTADAAAANKNAPLLGVVCGVCARLADKTPILEELKKDILAFYIKEVVSSK
FT                   SAVPAHVANGMPDFFTSFVTYEDVATELVPPMEKSILRAPEVVLGGVIPPLCASLPEEI
FT                   DLSELVQTRLSKNLLTSMKSNNPSIRQGASDSFASLLSRCRTDSLVLKITSEIVGPLKT
FT                   QKITTPEHRLAYAQAIGAISPSADVSKEIVQGFCPVFSRESNEAALEEEIKSFSKHLTY
FT                   LVQSKLKVSDDVISTIVKGVSDKRIPFRKIWQANVGEVLWTSDLEDLKAPETEPLLTKF
FT                   LAKMKDLFGEVASNPLPSAQSGALSSAYLFLALFHRVSDVQGSARSAWEEHVTQSMTLS
FT                   PKPSFLLNPRAYSKLSSKAEVQWLVRALAAVASGPNFSSSDDASKTAWAQTFIYAITAP
FT                   AIPSNIRENSAETLSRVYQTDVASFGRIVLNALWAWILSFRTADKESAAVSAGPESERL
FT                   LHMVLKALCPTKAVIETSGISSSDLEVLLIEMLILGRPELIPNTSWIELCLRTGTDPGD
FT                   LVRAHAANCIEQLVCVNTDPVQSAVPNVNLAVFSAGAELAFVAPDAMIPRLVDQIKYDL
FT                   DGTRLSKFTATDAAISRTPEGTAFVDVLSSKSKQPAFDKNTKDYDTLKWEEELRAQLAE
FT                   KKGQSQKKLTPEENSKVKAQLAKEAKIRQDVLEEVKRIERGAGLIRALATGPANDVEGW
FT                   INAAVSSLLSLAQAGAGLFVGDVVSRAFITCADEVSTRLGPLRPFVGIATLRAIGNTNL
FT                   PSDMELEPLGELVTRILYRLRFASEQRPFDATSLAYVLPLVSLILTKNGIEEGKGEEEG
FT                   TQVLLALEFLSFHSSSFTDTRLPRVEVLSQLLSAMQKYTQHYKLVKDTLFDFCRCISPS
FT                   INSEELDTLLQGTVVAEASVRTTVLQVIEAEIDLTDLDFSEHIWLGCHDIVEENAEIAD
FT                   TIWEDNALEVDDTSFSKIMKYLDSKDYQLRGAAARALAHAIEFDKSKFAGILSELQSKY
FT                   VEEIKPKAPEKDAYGMPKKVDNADHWEARSGIALAFNAMTNGFDGDESVSFLRFLIEKG
FT                   PLLDGNSRVRGQMTESGKSVIILRGESKVEEMMNLLQTTLETSDKDTKTSDLLNEAVIV
FT                   LYGSVATHLKADDPRLQTVISELLVALDTPSESVQHAVSECLPPLIRSSGSKTAEYVEN
FT                   LLHRLFNAPDYPRQRGAAYGLAAVVCGRGVATLREYRIMSQLKEAAENKKEKDHRRGAL
FT                   LAYELFALVLGRTFEPYVIHLVPQLLAGFGDTSISVRETCLEASRACFQNLSSYGVKEI
FT                   LPTLLDGLDDTQWRSQKGACDLLGAMAYLDPQQLAASLPDIIPPLTVVLNDTHKEVRSA
FT                   ANRSLQRFGEVISNPEVKSLVGVLLKALSDPTKHTDEALDSLIKVSFAHYLDAPSLALV
FT                   VRILERGLGDRSNTKRKSAQIIGSLAHLTERKDLISHLPIIVAGLNLAIVDPVPTTRAT
FT                   ASKALGSLIEKLGEDALPDLIPNLMATLKSDTGAGDRLGSAQALSEVLAGLGTTRLEET
FT                   LPTILHNVSSAKPSVREGFMTLFIFLPACFGNSFANYLSKIIPPILAGLADDIEAIRET
FT                   ALRAGRLLVKNFAHKAIDLLLPELERGLADDSYRIRLSSVELVGDLLFSLTGISGKQEG
FT                   DEEEEEATQAGQSLLEVLGAERRDKVLSALYICRCDTSGQVKSAALGVWKALVASPRTL
FT                   KDMVPTLSQLIIRRLGSSNMEQKVIASNALGDLIKKAGESVLSTLLPLLQDGLQASPDV
FT                   EVKQGICIALRELINAASPDALEDYEDILISTVRVALVDNDDDVREAAAEAFDSLQQIM
FT                   GKRVVDQVLPYLLHLLRNDEDAEQALSALLTLLTEQTRANIILPNLIPTLLTPPITAFN
FT                   ARALASLAEVAGSAMTRRLPTILNSLMDGIIETTDEELRTELSTAFDTVLVSVDEYDGL
FT                   SAAMNVMITLVKHDDHHRRAAAALHLTKFFAEAELDFSRYYQDLIRALLISFDDPDKDV
FT                   VKSAWTALAGLMSHMRKEEMESLAIPTRQILRQVGVAGADLPGFSLPKGIMAILPIFLQ
FT                   GLLNGTTDQRTQSALAMSDIIDRTRAESLKPFVTQITGPLIRVVSERSVDIKCAIFYTL
FT                   NKLLEKIPLAVKPFLPQLQRTFARGLADTTSETLRNRAAKGLGILITLTPRVDPLIAEL
FT                   IAGSKTTDIGVKNAMMKALQEVVGKAGANMSEASRQAILGLIDDDASDQTDSVAITNAR
FT                   LLGALVKVLPAASSVPLIKNRILTGSLSHAAVLGLNALLAECPEVLTEHFSVELPTVIC
FT                   QGLANQDPFISDNSALAAGKYLLSNDADHAFESSKVIFEALASAIQVGKPVDTRRLSLV
FT                   VIRTVSRLHPELARPHLALLAPPIFAGVRDLVIPVKLAAEAAFLSIFSVVESDSEVFDK
FT                   YMAGPGASLPPGPKRSMSDYFKRIAVRLANQARERREAEGGEGGLGLSNDEIDDEKELW
FT                   SIGKVDLGEAFGDE"
FT   CDS_pept        join(1195722..1196484,1196542..1198087,1198158..1199455,
FT                   1199505..1199718,1199780..1200107,1200174..1200383)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825428"
FT                   /orf_name="Pc13g04900"
FT                   /product="Pc13g04900 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91559.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001830EB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G7"
FT                   /transl_table=1
FT                   /translation="MPPSSKKKKKPASNPARGFATVSMPSKPKPEAATTPSSAAEESKP
FT                   TPENEPQPERTDVRTADAAAPPTTSSLQDYTPEELEKHLEEAELQILVDKYAFKCKNDA
FT                   TRQATKLDNERRVFRQQSVTLSLLEWLPTDIQDSILELGSTEEHDYLITSGRVPSSKQA
FT                   GSDEDLYNKLWTLKETLLKLDFPANRVEDALKHVLQYFAGNSANAGRDVVWNLDEAIEW
FT                   LATHSDKNELPSYTQTNTRQLKDTDSVTSWMTESKGSGTSTPISSQNRSKQENKKVDWK
FT                   AEKAATPLSYDSDSSVDPDIMVPEWLELQTQLYSLDPDLFDRPGKGKKGRGGAGNLSDD
FT                   PETSKVQRKIAKIERDVLFERREAEYIWEQKLDELRKDASFIRRPVDKKKKSPTDAEDQ
FT                   PKPEINEEIDPALLAIDGMEDALGDLFQGEAEDPGSILGIAPPESQTPVILRDFGKSTG
FT                   LSPRRVLEETCKSRDSSCVVVYQDFSSSGHSNRKALEVRWSKPQEVPFPLAVESITHKS
FT                   NALATFVSMDALATPTAQQAEGYVSTLALFILFPQNSKEGKAYLRLPAVWRDLWTEFAT
FT                   LQKTQQDEVDKSTLKELKLLIQENQGTFEDDVVLSDNFRKRNGVGSKPGTPVEGSTRDS
FT                   YPGIDDRLKEAWMAKSSTPSYQRMIQGRMNLPIWGFKDEILSTLDDHRALIICSETGSG
FT                   KSTQIPSFVLEHEMVHGRPCKIYVTEPRRISAISLARRVSEELGESKNDVGTNRSLIGF
FT                   AVRLESKFTQSTPLIYATTGVVVRMLERPEDFQDITHVVLDEVHERTIDSDFLLIVLRR
FT                   LMQKRPDLKLILMSATLDAQRFSNYLGGVPVLNIPGRTFPVEMKYLEDAVEMTNYRLSE
FT                   DVQHTVLDDDMDDPPTDADTTGGLQSSLDGYSRQTKETVINIDEYRLDYELIKRLLLKL
FT                   ATAPEMAHYSKAILIFMPGLAEIRRLNDEILSEPMFQRGWIVHTLHSSIASEDQEKAFN
FT                   VPPEGTRKIVIATNIAETGITIPDITAVVDAGKEKIMRFDERRQLSRLVESFISRANAK
FT                   QRRGRAGRVQNGICFHLFTKHRHEKLLSEQQTPELLRLSLQDLVLRVKICKLGEVEQTL
FT                   LEALDPPSSKNIRRAIDSLKEVKALTSNESLTSLGTQLAKLPLDVFLGKMIIHGAFFRC
FT                   LDATVSIAAILSSKSPFVNTIGSNSQRDGARASFRRGDSDLLTVYNAYCSWRRIRSTPG
FT                   SNEYSFCRKNFLSPQTLLAIEDIKMQLVVSIADAGLLTLDASQKAALNRARSNSRNRQF
FT                   FVIPEDFDINSNNDIVVNSVIAWSFYPKLLTREGKGWRNVGNNQTVTLPAVSVNKRADS
FT                   SVKWLSYYSIMARARNLSAHDTSAVDDFAIALLCGDAEFKMYAGVVSIDANRIRFAVRD
FT                   WKSMLALKILNSRLREILSNTFRNPHRPLSYKHQQWIDIWQQIFAQAGKR"
FT   CDS_pept        join(complement(1202580..1202700),
FT                   complement(1201505..1201844),complement(1201323..1201410),
FT                   complement(1201135..1201224),complement(1200948..1201028),
FT                   complement(1200773..1200853))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825429"
FT                   /orf_name="Pc13g04910"
FT                   /product="Putative uncharacterized protein Pc13g04910 "
FT                   /protein_id="CAP91560.1"
FT                   /db_xref="UniParc:UPI0001830EB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G8"
FT                   /transl_table=1
FT                   /translation="MTGCGNNHVGRARSCGFTASCPPLRADVAQSIISYSVAPSGVASR
FT                   SKNANTMQRAAQAASIMYDEESDKLACQVPAQGQEQVPVPPGDWVAVHEIVYIVSNRSQ
FT                   PDYRLWVRIIPGWAGARGDFHLLEVCLPFRLCMECRWRMGVGGWCILCLGNVWGVGMDG
FT                   VDSWNLPRFSCVFRPHDLAEVGISLDWGLGWRDCIVAAGRRRPIVSRGKMLCLDHDLIG
FT                   VAMIMQSFTHVGSVLTASYAVSRRSCRDATVPADRSPGSYLLSG"
FT   CDS_pept        join(1208042..1208125,1208372..1209329,1209404..1209536,
FT                   1209597..1210878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951953"
FT                   /orf_name="Pc13g04920"
FT                   /product="Pc13g04920 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP91561.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniParc:UPI0001830F7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G9"
FT                   /transl_table=1
FT                   /translation="MCSTIVNDLDDYCASLNSSFSKSLYCASHDGRHLRRPLLASSLYS
FT                   KPFIRATEKLELPSISQVHTRGPADIPWYNPHAAERPLLPGDKLPALSLPTATQGLSRT
FT                   AYPDPSVTNSTNSSARTSLSSASVPVNEPRSPPSSADLSGTQGRLSLDSSAPTEYSLPP
FT                   SVNEGYYPSPTSLGSMNQTQPYMDVHSHMSSAQSYAPQGATAGAMSQYQYHGQPPVMQP
FT                   ASSYAPAAYPQYGYPTGVTSPPTGHPPSSMGGQMPAQLLPLPGKLQSQNVIEDYSDRYQ
FT                   VSNHAVAPPSGYGNSTGAPLQGFVFDGTGQVAPPGAKPRVTATLWEDEGSLCYQVEAKG
FT                   VCVARREDNHMINGTKLLNVAGMTRGRRDGILKSEKLRHVVKIGPMHLKGVWIPFERAL
FT                   EFANKEKITDLLYPLFVHNIGGLLYHPANQTRTNMVVQESQQRRLEGPPPGPQRTPSGS
FT                   QQGPIHHHHPSLQTPMSSHMSQGPMNGQPGSRPGLERANTFPTPPASASSMMNQGSSYE
FT                   WGGQVPHTQPLSIDTTLSNQRSMPTTPATTPPGNNMQGLPAYQGQGYDSSKPYYSAAPQ
FT                   THAQYAPHTPLTQSGMSSYGQPLAGGYMKSEMAPPNPRPGVSEPETSERDSNRYSQSNG
FT                   PGETVAEHDQEYMQDHNAGYNSNRGSYTYTTNPSVSSLTGEHSQLTPEMTSSPSQQNGS
FT                   GRMTPRTGAGPPPHWASGYNTPPRPAATTLYNAVSDTRGTPANGASDPYSMASTTAPVY
FT                   PTGNGSLSAGSKRMREDDDIRAESTAEYETSKRRKTITDATLGGPVGGPPILQPMKPSG
FT                   VMARHR"
FT   CDS_pept        join(complement(1213930..1214166),
FT                   complement(1213004..1213870))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825430"
FT                   /orf_name="Pc13g04930"
FT                   /product="Pc13g04930 protein"
FT                   /protein_id="CAP91562.1"
FT                   /db_xref="UniParc:UPI0001830F7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2H0"
FT                   /transl_table=1
FT                   /translation="MHMRTLLLLIWAIAAPALGWRGEMPAQRSYMYVGGQYILNSAGQH
FT                   VFADQMYVEKLTPAAGITKPYPIVFIHGQAQTGTNWLNKPDGGEGWASYFLSQGYACYI
FT                   IDQTFRGRSAWFPGNGTMNTYSAELLQQRFTAPKLYNLWPQASLHTQWNGTGVMGDPNF
FT                   DNYYSSTVEFLSSATHQQSTVQAAGATLLDTIGSPVILIAHSQGGTIPWLLADVRPNLV
FT                   HSIVSIEPTGPPFQDAVFSNSSTRAYGLTDIPLTYSPALADPVELVKHVIPSNSSLYSD
FT                   CVIQADSPAPRQLVNLAGVPILVLTTESSYHAPYDWCTVKFLQQAGVPAEHLQLADIGI
FT                   HGNGHMVFMEKNSLQVAAVLQKWMERT"
FT   mat_peptide     join(complement(1213930..1214109),
FT                   complement(1213007..1213870))
FT                   /db_xref="UniProtKB/TrEMBL:B6H2H0 "
FT   sig_peptide     complement(1214110..1214166)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2H0 "
FT   CDS_pept        join(1214528..1214721,1214835..1215073,1215140..1215171,
FT                   1215199..1215320,1215377..1215776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951954"
FT                   /orf_name="Pc13g04940"
FT                   /product="Pc13g04940 protein"
FT                   /protein_id="CAP91563.1"
FT                   /db_xref="UniParc:UPI0001830F80"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D6"
FT                   /transl_table=1
FT                   /translation="MDSTLIILWVFTWVAIGLIVLRLLLRKLKGRQFILGDYFAMGAIL
FT                   CALVRLALVHVILIWGTNNMLNGIAGSSRYFFSHVSFSLWLQKLVLLDTYRRLLTNLRW
FT                   EKATMISYIGIFAATYIIVQIVTFTECDPFSHYWMVLPDPGICCRAQLQLIVVSMHSSN
FT                   IVVPSGVLNVITDIMLIALPIPILVLVKRSTIEKIQLAALFAVGLFIVAITIARLPQNA
FT                   KNSTAQVNRTTWASIELLAAAIVANAPVLYGLLKGQSERSKNAASGAGSTGPSQGIKKR
FT                   PANEPEFELQRTRHSKRGSALGSRISSRNYLEIDGESSQSLTRSLEN"
FT   CDS_pept        join(1216154..1217034,1217099..1217190,1217333..1217397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129809"
FT                   /orf_name="Pc13g04950"
FT                   /product="Pc13g04950 protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91564.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001830F81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D7"
FT                   /transl_table=1
FT                   /translation="MNSDRPERERPAKPQLPEPRNHLHFDPWQSASTGHQRADQGGSFL
FT                   GSTSWRDARSAKLTMQYRSGDCLPGRGTGPGPANKTTQKTTLVPGAFDGKCASESPPKA
FT                   PASGEWAMVAGDVAKRNELDVRDIRSFMGVSKRKAVDELGNETKAEMKKPRTVSGGNGS
FT                   LSPALYAKEMDKETEKSEIEDNPQPKSRSGTGLDLKATSRIFAGVTIFINGSTLPQISE
FT                   YKLKHLLASNGAKTSIYMARKTVTHILVGQPNTGSGTGTAVSGAGGGLAASKLQQEITR
FT                   GGWKGVKVVSVDWALESIKAGRRLAESRFPGMHVAAKGQRSVAESWFPVNLLGWDDESS
FT                   NYMHL"
FT   CDS_pept        join(complement(1219632..1220390),
FT                   complement(1217858..1219579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978595"
FT                   /orf_name="Pc13g04960"
FT                   /product="Pc13g04960 protein"
FT                   /protein_id="CAP91565.1"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI0001830F82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D4"
FT                   /transl_table=1
FT                   /translation="MDPNSALSHANNLLARAETSGRPPVYKAVGISLAVASGVFIGISF
FT                   VVKKIGLLKANVKYNEEAGEGYGYLKNFWWWTGMTLMIVGEICNFVAYAFVDAILVTPL
FT                   GALSVVITTILSAIFLKERLSFVGKVGCFCCIIGSVTIAMNAPEQSSVKDIQSMQHFVI
FT                   QPGFLVYAGVIIVGAAFTALWAGPRYGKSSMFVYISICSMVGGLSVVATQGLGSAILAQ
FT                   INGQEQFKHWFLYVLFVFVIGTLLTEIIYLNKALNLFNAALVTPTYYVMFTSATIITSA
FT                   ILFQGFKGTGVQIATVIIGFLQICAGVVLLQLSKSAKDVPDAAIFKGDLDQIREVAEVE
FT                   EPESEPKADSIRGTASIIRRISTARRTMETDEARRFFHDKHEDTLKVPAENEIIEWDGL
FT                   RRRKTVIGEGPTMSRPITPRTPSVKQHPPWGMSRFPAVEDEENHRPNTKQSGHSFMDSI
FT                   RSRATSVLHPSQWKAVNTEDEKSSNANTQPVGMTGLAQQNGNADAEYHGAGMAGGLEVP
FT                   FNANRPRSDTLRSVSWADEKAESLTPEPIANTARRQFSFNNMMGRMKADSESSVKPTPG
FT                   SPRGILRRTHLAADMRKSATEEESLGLVHGDSRRSQPEEELLNEKLDRWSSAESELGEP
FT                   QPMFAGRSHGNSVSSNISTAAFPAYEDNHHHYSESNNPYYLPHNRQTASSPEPISRDEE
FT                   GWKHPSSRGSGSRTRTRTNSSVHAHSRAPPPAQSSFSTHRHPNPLPPLPDITPTTTLDL
FT                   MPTATNVPALRSVSSESDMVTTLSSEIEDPNDPPPVYPSRQQSGWRRHMSDNSSHDGET
FT                   YATRGGRGSSFRRT"
FT   CDS_pept        join(1220411..1220447,1220467..1220598,1220657..1220773,
FT                   1220874..1220953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978596"
FT                   /orf_name="Pc13g04970"
FT                   /product="Putative uncharacterized protein Pc13g04970 "
FT                   /protein_id="CAP91566.1"
FT                   /db_xref="UniParc:UPI0001830F83"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D5"
FT                   /transl_table=1
FT                   /translation="MATLTSSGKRRRESSEDETQRLFETLGDAATISIKIGRIAGATIN
FT                   EGPASTMVPSRGNASGKCPRGKEKCGIPQGGKSAVGAKTFGGKWQGSDFEGEGKEIEMQ
FT                   NKEAGPCGERRRYWYSW"
FT   CDS_pept        join(complement(1223339..1223405),
FT                   complement(1222703..1223288),complement(1221410..1222643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951955"
FT                   /orf_name="Pc13g04980"
FT                   /product="Pc13g04980 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91567.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001830F84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D8"
FT                   /transl_table=1
FT                   /translation="MDPANLRRKDTTKGPPLRILSLDGGGVRGYSMLILLQELMYRTYV
FT                   ECEGKPPRRDQIPKPCDHFDLIAGTGTGGLIALMLGRLRLDLETCKEVYVRMTRKVFET
FT                   DKTIAGIPYRSTLFKASKLEEAIRECVREHTVYETEGNDTGNAPNRDSMASMTSLPYSP
FT                   ASIPQRSISRGSFSTAAASHPMSPTSQRGSVFLNGLRWGNPDALLYDNRENRTKTAVTA
FT                   MYKGTPRKGTAVLLRSYDSRREPPPEFDCTIWQAGRATSATGLAFKPIQIGQHHFIDEG
FT                   HGTFNPAPLVLDEAVVNEWPGREVGVFVSVGTGKRPPGTNNRQHEWWEDFFSDSLGTFA
FT                   EARRRLMTKIEGCEDIHNDMLRDRLAKRNVSKDNYFRLNVEVGVGEFGMNEWHRLADIS
FT                   TNTRQYLARPEVKKMILEAGVRFAKIDRMNRRLASHAAAGGDRDDLSFDLETEELSLSP
FT                   PVQSHVPPPAHFAVELPAELPADFVGSAHHPPPSQAPLPIPTVVTTSPTEDTLPIHPTP
FT                   QDSISVSSPRQSGSDYRRSHELASRPSSQQQSSPTQSGEYFATFNGMAPPVPPKTPIPY
FT                   PAQEDDGGVAMPAPLFSQAPSSTSNTKVRPPYPVDEPPPTVNRQRKPSYHVR"
FT   CDS_pept        join(complement(1225563..1225577),
FT                   complement(1224316..1225507),complement(1224233..1224255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672740"
FT                   /orf_name="Pc13g04990"
FT                   /product="Pc13g04990 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91568.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniParc:UPI0001830F85"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D9"
FT                   /transl_table=1
FT                   /translation="MKVSQLYVYPVKSLRPTTITEGILTTRGFRYDRHFMLLKVIPVED
FT                   GSGTTTLKNMHVPHFPEMALFRTDIEYPETEKDSGKLIITYHPPAESATRPRETNRLEI
FT                   PLQPDPKALNPLKIVMHQSPTTGYNMGAEYNNWFSARFGYPVVLAYLGPHSREVLGTLA
FT                   PAKKDKKTPLRTICESLTSPDRKWERVLPILIVASAINILLHGGTIIRDGITPQTARSL
FT                   SPTIFTASAVVLVLVLYYFYTVHAQHEDRITFADCAPYLVISETSVDNVSARLPDGEEM
FT                   DRTKFRPNIVVSGAGEAFEEDFWGALTVNAGLERGSSRLLLTGNCVRCQSLNVDYETGK
FT                   MGTGESGAVLKKLMKDRRVDSGAKYSPVFGRYAFLEPKGEGISLRVGDEVMVSEKGTKR
FT                   SIFDWPGMTN"
FT   CDS_pept        join(1226250..1226603,1226675..1226777,1226832..1227184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951956"
FT                   /orf_name="Pc13g05000"
FT                   /product="Pc13g05000 protein"
FT                   /protein_id="CAP91569.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830F86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E0"
FT                   /transl_table=1
FT                   /translation="MDSAELQDGTCHPRWDVLYSAAGFSPPVPETINDRASEKCNMLNP
FT                   GGVTVLRLSPDMVVKYGPHVTITEAQSMIFVAEHTKATPIPKVFAYCTYGPLNRDIDDY
FT                   GSLFDTYIFMSLVGTYMDELREIRSEPYIGSVNKGPVRDQTFDNFHVKGPFESEETFNE
FT                   TILDAYQANFPKRHIRSFLAGMLSQKRHSVCFTHADLRPQNIMVRGGSITGIIDWELSG
FT                   WYPEYWEFAKALYVWRWQNDWVDYLTKALEPYYNEYAVHSFVAEALW"
FT   CDS_pept        join(complement(1229367..1229519),
FT                   complement(1229252..1229308),complement(1229100..1229193),
FT                   complement(1228903..1229040),complement(1227704..1228848))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672741"
FT                   /orf_name="Pc13g05010"
FT                   /product="Pc13g05010 protein"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="CAP91570.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI0001830F87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E1"
FT                   /transl_table=1
FT                   /translation="MYLSRCGRSAARLLPLGSSRAAVVSARASIVPRLAPQSRGVATST
FT                   RDTQHKLLAASLEESDPTVWNILQKEKQRQKHFINLIPSENFTSQAVLDALGSVMQNKY
FT                   SEGYPGARYYGGNEHIDASERLCQQRALETFRLNPEEWGVNVQPLSGSPANLMAYSALL
FT                   NTHDRIMGLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSAT
FT                   LYRPKLIIAGTSAYSRLIDYPRMRAIADSVGAYLLADMAHISGLVAADVLPSPFPYSDV
FT                   VTTTTHKSLRGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTIT
FT                   ALSVALKQAQSPDFEAYQKTVLRNASALAGRLGDSTSNGGLGYNIVSGGTDNHLVLVDL
FT                   KNRGVDGARVERVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVA
FT                   DIVDRAVTITQKLDKAARESAQSRGVKNPNTVKAFLDYVGEGEEISEIVVLRQEVEDWV
FT                   GTFSLPWADDQ"
FT   mat_peptide     join(complement(1229367..1229435),
FT                   complement(1229252..1229308),complement(1229100..1229193),
FT                   complement(1228903..1229040),complement(1227707..1228848))
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E1 "
FT   sig_peptide     complement(1229436..1229519)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E1 "
FT   CDS_pept        complement(1231135..1231470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951957"
FT                   /orf_name="Pc13g05020"
FT                   /product="Putative uncharacterized protein Pc13g05020 "
FT                   /protein_id="CAP91571.1"
FT                   /db_xref="UniParc:UPI0001830F88"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E2"
FT                   /transl_table=1
FT                   /translation="MLLLHGANPSPEEPPGTNFVAPGLAVTLENYAVAQLLREFIDLAE
FT                   IIRLGGRNQEWLMLTAAACAWDDMLRKVLDKSCLMDTRVDSLDAFYSTTTSDLALENLP
FT                   AISLAAG"
FT   CDS_pept        join(1233194..1233337,1233388..1233470,1233528..1233771)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129810"
FT                   /orf_name="Pc13g05030"
FT                   /product="Pc13g05030 protein"
FT                   /protein_id="CAP91572.1"
FT                   /db_xref="UniParc:UPI0001830F89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E3"
FT                   /transl_table=1
FT                   /translation="MRFSIAALTLGAAGAMAGVVTETVTEYTTYCPEATSVVHGSKTYS
FT                   ISTPGYITMSHGPYTVTRPLVTSTVTECNSCSSTPAVSTPVASSSVPLIPVVPSVATST
FT                   PLVPSAGSTGVPSAPSSAATPSQPAFNAGAINAATGAGAGLAAVFGAVALLL"
FT   sig_peptide     1233194..1233244
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E3 "
FT   mat_peptide     join(1233245..1233337,1233388..1233470,1233528..1233768)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E3 "
FT   CDS_pept        join(1234400..1234468,1234592..1235413)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978597"
FT                   /orf_name="Pc13g05040"
FT                   /product="Putative uncharacterized protein Pc13g05040 "
FT                   /protein_id="CAP91573.1"
FT                   /db_xref="UniParc:UPI0001830F8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E4"
FT                   /transl_table=1
FT                   /translation="MSAIPKENVQASTRLKDPTHAQQEFFDADSPESIATPATKKRKRD
FT                   GSRAKRLRMSSSMETISPGSIHSKTSETSHKRSPKESKRDNSATKSAMSREMQQCTSSE
FT                   PARLELPPKPASEQKAVNDNVFTNTNPFGLADLPPSEFVFPRDVDFDYPCDERETSYEP
FT                   VSECLPEHPQVPTPYTPVLRAGSQYNQRIWNQYGGKCETWLARQLYDELHDITTRIGDI
FT                   MCGIRLMLDMRGPSDGFEGLGEHHFEAEESHGALKGDGPEDPLELSDNDDKALFVSGTD
FT                   EPSSSDEFSGFSGDE"
FT   CDS_pept        complement(1235621..1236676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825431"
FT                   /orf_name="Pc13g05050"
FT                   /product="Pc13g05050 protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91574.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0001830F8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E5"
FT                   /transl_table=1
FT                   /translation="MSTQTTTTRNPADSMVSTWRHDRSQWNTYHWMIELLGLHLIDFDA
FT                   EVPIFSKKDKIPAIREWTVHLWILLHAAIPLAIHHAYTIYTGQNMHLIGAFALYSSAFK
FT                   LNGIHEMHIMRRLGQVYGFLDGDKHPRDEIPDVGVGKVIRELISTSTLRMVMAIFLTYR
FT                   PGETPTSLEWKWLPLEIGLYSITVDFWFYWYHRMMHSVGPLWKFHRRHHLTKHPNPLLS
FT                   AYADHEQEFMDITGIPLLAYTTLKIIGLPMGFYGWWICFQYIAFSEFIGHSGLRLHGGA
FT                   PSTVNWLLEIFDAELVIEDHDLHHRYGWRKSHNYGKQTRLWDSIFGTCHERIESVKENV
FT                   DYTNRVTMPLL"
FT   CDS_pept        join(1238132..1238536,1238594..1239529)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672742"
FT                   /orf_name="Pc13g05060"
FT                   /product="Pc13g05060 protein"
FT                   /protein_id="CAP91575.1"
FT                   /db_xref="UniParc:UPI0001830F8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E6"
FT                   /transl_table=1
FT                   /translation="MESTKVPKRPTLRWNKCRRQVLCCLFRFFVCSKKQTEEIFSYMFR
FT                   SHLNDRGIQGFVPFATLNTQWVWMKTRRDPVWSHVHTSTVFDTDEEWKEIIARIKSAAK
FT                   TLRFELLEKTADTNISRSSSAGADDERSITLNGPAAPMLPHSFSTPETLSPMVLVSPRG
FT                   DYGFGENSRANQSIEQNVDLTIDRTIDQRNDSQNDLYNELNRPNEPVVTGHGKLCFWCK
FT                   HEGAIYDPEEELQNEVYNDSGYEDDSRGNEHDNPQDDPVMREYARGLKQFTRELHGEVP
FT                   YSDEESPDSGSEAYLMTPHEGLSNVRHFCDPHISSLSNLEQEPLDSEDNSDWCADRESP
FT                   VDLTGFGTPSISEDQNGSLVDERISAREALSRFRFPHTRAGRDETPDDGLSRRASRYEW
FT                   PPNDEIMVETLRQLSVEALRQVENQSNNRTHQEMDVLMYDGNTWNQV"
FT   sig_peptide     1238132..1238239
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E6 "
FT   mat_peptide     join(1238240..1238536,1238594..1239526)
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E6 "
FT   CDS_pept        join(complement(1240971..1241365),
FT                   complement(1240812..1240919),complement(1240455..1240752),
FT                   complement(1240322..1240396),complement(1239707..1240273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672743"
FT                   /orf_name="Pc13g05070"
FT                   /product="Putative uncharacterized protein Pc13g05070 "
FT                   /protein_id="CAP91576.1"
FT                   /db_xref="UniParc:UPI0001830F8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E7"
FT                   /transl_table=1
FT                   /translation="MSDNPGDGKNPRRARKPQGFFSERQQEQRNAAARGQLEVDLPIRP
FT                   KDKRAAPDDSQAESSPKKKQKKEATKPKPLDVKAFMDDLKTDYSKRRLKPMPPRPPKQK
FT                   WRPVKTAITDRAKAPKGWNPREPDLINDDLQSQITRCRERIKENIMPHVYEHKLEELLV
FT                   GQERDKKMAAEKGLSWPVVRRLEDLQSILEWAQSNAIKDKYKIANNVQNVILAYRSGGL
FT                   DWCHGFVTYWHNGAQLCAPRPFKWDEFQYLYDEYKGNETGFWVEGIDGPGPSSQQAVIE
FT                   CGTGSRKWAAEMSISLRIPTTGGKPSPRSFEFSFKDDTGADYMVLYENDVNRLRINLQA
FT                   QGLMYPIPRLLGVLVVTLGDGSKKAMLVRELEVNMWDEHEKQYMADSWDSIPVAVLPGR
FT                   GTKRLNGPWMRWKFYTATAPDNSNRLWIYDYNPSNPLMRGPKIPTATKAQMDRALPTAH
FT                   KYESIENHPQFNPDIPSGKSII"
FT