(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE101

PENCW_10.PE101       Location/Qualifiers
FT   CDS_pept        join(complement(243017..243449),complement(242717..242967))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977829"
FT                   /orf_name="Pc13g01010"
FT                   /product="Putative uncharacterized protein Pc13g01010 "
FT                   /protein_id="CAP91170.1"
FT                   /db_xref="UniParc:UPI0001830438"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L4"
FT                   /transl_table=1
FT                   /translation="MALGIIRDKVISLKNHGLSIEDRKVLKEDRRLLFAWVDEAPNDRE
FT                   TPVTKWRKARSRKAYRTIQDASEQLFLAAILSITPTQCARKSFDRVLESLMRLNHEEFY
FT                   FTLGPETKSFLEAIAAEQGFAGNRQYLAFMKSLFPRIEPRQIQFAYSLVRRNDIPSFLG
FT                   KMLEGITSSQEWAKEESQGGNTTGCVTIIIPTNEHEDGSCNIRVNRTLLMQAIHDFRIT
FT                   SLKLE"
     atggcgctag gtattatcag agacaaggtc attagcctca aaaaccacgg gctaagcata        60
     gaagatcgca aggtgttgaa agaagaccgt cgtcttttat ttgcttgggt cgacgaagcc       120
     cctaatgacc gcgaaacgcc ggtcacgaaa tggcggaaag cacgatcccg aaaggcttat       180
     cgaacaattc aggatgccag tgaacaactc ttcctagctg cgattttgtc cattactccg       240
     actcagtgtg cccgaaaaag tttcgaccga gtactggaga gtctgatgcg tctgaaccac       300
     gaagaattct actttacact cggtcctgaa acgaagagtt tcctagaagc catcgcagca       360
     gaacaaggct tcgctgggaa tcgtcagtac cttgctttca tgaaatcgct tttcccacgc       420
     atagaaccga ggcaaattca atttgcatac tcgcttgtga ggcgcaatga tattccatcg       480
     ttcctcggaa agatgctgga ggggattacc tctagccaag aatgggccaa agaggagtcg       540
     cagggaggta acactacagg ttgcgtgacc attatcattc ccactaacga gcatgaagat       600
     gggtcctgca atatcagggt gaatcgcaca ttgttgatgc aagcaattca tgattttcgg       660
     ataacaagtc tcaagctcga gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page