(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE102

PENCW_10.PE102       Location/Qualifiers
FT   CDS_pept        244929..245282
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948725"
FT                   /orf_name="Pc13g01020"
FT                   /product="Pc13g01020 protein"
FT                   /protein_id="CAP91171.1"
FT                   /db_xref="UniParc:UPI0001830439"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L5"
FT                   /transl_table=1
FT                   /translation="MPSKTQKSLEALMAYIKQSKSRRTTILRGQGEPGHRAAPARGGNH
FT                   DARIGSRIDIGEIVKKTGKEYRRYKFQLNSNAEDSTLKRKAAQDSHKVYSTADVEIKES
FT                   RTQEEEEQAMRDF"
     atgccttcca agacccaaaa gtcgcttgag gctctcatgg cctacatcaa gcagtcgaaa        60
     agccgccgca ctacgatttt gcgtgggcaa ggtgaacctg gtcaccgggc tgccccagcg       120
     cgtgggggta accatgatgc gagaattgga agccgcatcg atattggaga gatcgtcaag       180
     aaaactggca aggaatatcg acggtacaaa tttcagctca attcgaacgc ggaagactcc       240
     actctcaaga gaaaggctgc tcaggattcc cacaaggttt attcgactgc agatgtggaa       300
     attaaagaga gtaggaccca ggaagaagaa gagcaggcga tgcgagactt ctag             354
//

If you have problems or comments...

PBIL Back to PBIL home page