(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE103

PENCW_10.PE103       Location/Qualifiers
FT   CDS_pept        join(246066..246090,246141..246436,246495..246873,
FT                   246953..247830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948726"
FT                   /orf_name="Pc13g01030"
FT                   /product="Pc13g01030 protein"
FT                   /protein_id="CAP91172.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183043A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L6"
FT                   /transl_table=1
FT                   /translation="MDIASSQTDWNSNDEFFKFTRGRFIVNEAENLRKREIRFDLNSLA
FT                   RVAADSVGAGRCIAIKKYPDGMFNKAYLMCMDDGQEVIAKVPNPNAGVPHFTTASEVAT
FT                   MDFARKILDTPAPRVYTWNSQAKSHPVGAEFIIMDKIKGVPLSQVWSTMKLPQKLQVLL
FT                   AMTRLQKQWLSVTFSHYGSLYYTEDVRPPAGNHFVKDGKVVKDSEFAIGPATGRDWCDA
FT                   GRSNLDVEKGPFGAREVKATQSLEPPKPIALFCGPKLYRPDTEKKITALAWYRQVVGAL
FT                   IPKDTAITRSCLWHNDLHDDNVFVDPDNPAKITGIIDWQSCHISPLFNHNPDPAFLSWD
FT                   GLEPETLDLAPQPKLSGLSPEERSAAVHEYTLQNVFIGWRKLMHAKNPDLYRVVEFRRT
FT                   AAYGLIFLAHRMFEYGEAHFQSLLVDLKDTWTDLPAISSDTPFPFDFSEADFERIKLDS
FT                   NGAVAGTDLVAEVKERMGDLWPDKGFIEHERYDDCKAALHEVKGLILEQLAENDQEKAE
FT                   YERFWPFE"
     atggatatag cctcttctca gacagactgg aattcgaacg atgaattctt caaattcacg        60
     cgtggccgct ttattgtcaa tgaggcagag aaccttcgaa agagagagat tagatttgac       120
     ttaaacagcc tcgcaagagt cgccgcagac tctgttggag ctggccgatg cattgctatc       180
     aagaagtacc ctgatggcat gttcaacaaa gcatatctca tgtgtatgga cgatggccaa       240
     gaagttatag ccaaggttcc caacccaaat gctggcgtcc cacactttac tactgccagt       300
     gaagttgcca cgatggactt tgccaggaaa attcttgaca caccagcacc tcgtgtatac       360
     acatggaact cgcaagccaa atcgcaccct gttggggctg aatttattat catggataaa       420
     attaaaggtg ttccactatc ccaagtctgg agcacgatga aattaccaca gaagcttcaa       480
     gtgcttcttg ccatgacacg cctccagaag caatggctaa gcgttacatt ctcacattac       540
     ggcagcttgt attacacgga agacgtccgg ccaccagcag gcaatcactt cgtcaaggat       600
     ggcaaggttg tgaaagattc agagtttgcc attggcccgg ctacaggcag ggattggtgt       660
     gatgcaggcc gatcaaactt agacgtcgag aaggggccat tcggggcgcg agaggtgaag       720
     gcaacccagt ctctagaacc tccgaagccg attgcattgt tctgtggccc aaagctgtac       780
     cgaccagaca cggaaaagaa aattactgct ttagcatggt accgacaagt cgtcggtgct       840
     cttatcccaa aggatacagc tatcaccaga tcctgcctct ggcataatga tttgcatgat       900
     gacaacgtct tcgtagaccc ggataatccc gcaaagatta cgggcattat cgactggcag       960
     tcttgtcaca tctcacccct gttcaaccac aatcccgatc cagccttcct cagttgggat      1020
     ggccttgagc ctgaaacgct cgatctggca ccacagccga aactctctgg actttcgcct      1080
     gaagaacggt ccgcggctgt acatgagtat acccttcaaa atgtgttcat tggatggcga      1140
     aaactcatgc atgcaaaaaa cccagaccta tatagagtag tcgaatttcg aaggacggca      1200
     gcgtacgggc tgatatttct tgctcaccga atgtttgaat atggcgaggc gcacttccaa      1260
     tcgcttctgg tcgatctgaa agacacgtgg acggacttac ctgccatctc cagcgacacc      1320
     ccatttccgt tcgacttttc ggaagcagat ttcgagcgta tcaaactgga tagcaatggt      1380
     gcagtggcag gaaccgatct tgttgcggag gtcaaggaga gaatgggcga tttgtggccg      1440
     gacaagggct tcatcgagca cgagcgatat gatgattgca aagctgccct ccacgaagtc      1500
     aaaggcctga tattggaaca attggctgaa aatgaccagg aaaaggctga gtacgagcgc      1560
     ttctggccat ttgaatga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page