(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE104

PENCW_10.PE104       Location/Qualifiers
FT   CDS_pept        complement(247993..248463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948727"
FT                   /orf_name="Pc13g01040"
FT                   /product="Pc13g01040 protein"
FT                   /protein_id="CAP91173.1"
FT                   /db_xref="UniParc:UPI000183043B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L7"
FT                   /transl_table=1
FT                   /translation="MASIFRLPSRISRQTFSWRSSFLRSVSPVREFSQSSFPLLDPTQK
FT                   FEEETLSGYSPDGFYPVKIGEVFQSRYQVVGKSWRHGSRGESCNIPFNGKDVIPTLPGI
FT                   RHGGFKGTPYMIQNFHEVFQDQPGPPRGLTEWLESWEAGQELEDVPDDDLQE"
     atggcctcaa tcttccgctt gccgtcccgg atttctaggc aaactttttc ctggcgttcc        60
     tcgtttctac gttctgtgtc acctgtgcgc gagttctccc agtcgagctt ccctctcctc       120
     gatccaactc aaaagttcga ggaagaaaca ctgtcagggt actcgccaga tggattttat       180
     cccgtgaaaa tcggcgaggt attccaatcg aggtatcagg tggttggtaa atcttggcgt       240
     cacggatctc gaggggaaag ctgcaatatc ccattcaatg gaaaggatgt gatcccgacc       300
     ttacctggta tccggcacgg ggggttcaag ggtactccgt atatgatcca gaacttccac       360
     gaagtgtttc aggatcagcc cggtcccccg agggggttga cggaatggct agaaagttgg       420
     gaggcagggc aagaacttga ggatgtccca gatgatgacc ttcaagagta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page