(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE106

PENCW_10.PE106       Location/Qualifiers
FT   CDS_pept        251592..252110
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948728"
FT                   /orf_name="Pc13g01060"
FT                   /product="Pc13g01060 protein"
FT                   /protein_id="CAP91175.1"
FT                   /db_xref="UniParc:UPI000183043D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N3"
FT                   /transl_table=1
FT                   /translation="MELHMLSGSEDRHPIGASDLVTKLKWQLDQDLDHNCTPLGPCGSY
FT                   DAPFKITCATFGYTVVGKGTTSRLWGEVSREAEVYRVLQRTQGSAVRVFLGAIDMAQIY
FT                   FLHGAGKICHMLLMGWGGLSVSHMTLDKTIQHASVKEIRSLGICHQDLRPENILWNAEL
FT                   ERALIIDFH"
     atggagctgc atatgctcag cggaagtgag gaccgccacc cgatcggcgc atctgaccta        60
     gtgacgaagc tcaaatggca gctcgatcag gatctggatc ataactgcac tccgttaggc       120
     ccttgtggat cctacgacgc accattcaag attacttgtg ccaccttcgg atataccgtt       180
     gtcgggaaag ggacgacttc gaggctctgg ggggaggtgt cacgcgaagc agaggtttac       240
     cgggtcctcc agcgtaccca aggatcagca gttcgagtct ttctcggtgc tatcgatatg       300
     gcccaaatct acttcctcca cggcgcggga aaaatctgtc atatgctact gatgggctgg       360
     ggtggactaa gcgtgagcca tatgactctc gacaagacca tccagcatgc gtcggtgaag       420
     gagatccgtt ctttgggcat ttgccaccag gatcttcgtc cggaaaacat cttgtggaat       480
     gctgagcttg aacgggcctt aattattgat ttccattga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page