(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE107

PENCW_10.PE107       Location/Qualifiers
FT   CDS_pept        join(complement(252897..253019),complement(252793..252844),
FT                   complement(252644..252708),complement(252423..252599))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948729"
FT                   /orf_name="Pc13g01070"
FT                   /product="Putative uncharacterized protein Pc13g01070 "
FT                   /protein_id="CAP91176.1"
FT                   /db_xref="UniParc:UPI000183043E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N4"
FT                   /transl_table=1
FT                   /translation="MQDITEVPPGSKPYLSYQETPPKGIGLDNLVDDISHACLSQARQC
FT                   DISFGALSRGAGPSFPSWHLGISEISVLAPNAELKGLRSHRGPMASIMRAACRYLSPAD
FT                   KNLLADADLPLSIAEKDNMARHGYQIRRWRRSVS"
     atgcaggata taaccgaggt tccaccggga tcaaagccgt atctaagtta ccaagagact        60
     cccccgaagg gcatcggtct ggataatctg gtggatgata ttagccacgc ttgcttatcg       120
     caggcacgtc agtgtgacat tagtttcgga gccctgagtc gaggtgcagg tccaagtttt       180
     ccttcatggc atctcgggat ttcagagata tcagtgctcg caccaaacgc tgagctgaag       240
     ggtttgagga gccacagagg cccaatggcc tctatcatga gagcagcttg taggtatttg       300
     tcacctgctg ataagaatct gctggccgat gcagatctcc cactatccat agccgagaaa       360
     gataacatgg cacgacatgg ctaccaaata cgccggtgga gacggagtgt tagctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page