(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE109

PENCW_10.PE109       Location/Qualifiers
FT   CDS_pept        join(255884..255979,256035..256323,256361..256399,
FT                   256530..256721,256783..257028,257482..257639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948730"
FT                   /orf_name="Pc13g01090"
FT                   /product="Putative uncharacterized protein Pc13g01090 "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91178.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183043F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N5"
FT                   /transl_table=1
FT                   /translation="MAGDFGLQRQCQTCLAIFPTNDALRYHLEVYRLRERTLTLEIEKC
FT                   RAHAAPIYDPNKLCESCQVNAALTVASSNVSYQSDGEKDNGKDSISETTATLRSLGRRV
FT                   SKCPYYGCGKPFGSRKGLLKHFELPNRGFGTRRRLQRTIMKLDQMIETLESSSNDADLK
FT                   TPKRTLGETDLGQNSCPLRRVRARCKNGEALLDTTSEKAPQHVELQDKPFTSFELQPAY
FT                   EAVDMFAPLLFHDCPPPPTDNFDPPFFEASSSVGYRTQLGDGDPVGFCADITDPIPETE
FT                   FRFAWDENNFRPTTPQFHDQNMPARLLTPTSELKDVPWITVEFPVPGKTARRKKGLED"
     atggctggcg acttcggttt acaacgacag tgtcagacat gcttggcaat attcccaacg        60
     aatgacgcat tacgttatca tctcgaagtg tacagattga gagaacgaac tttaaccctg       120
     gagatagaga agtgtcgagc gcacgcagct ccgatttacg acccgaataa gctctgcgag       180
     agctgtcaag taaacgcggc actaactgtc gcttcgagta atgtcagtta tcagagcgat       240
     ggcgaaaagg acaatggaaa agatagcatc agcgaaacta ccgcaacttt gagatcgttg       300
     ggtcgccgcg ttagcaagtg cccatactac ggttgtggaa agcctttcgg gtcgagaaag       360
     ggtcttttga agcactttga actgcctaac cgcggatttg gaaccagacg tcgattgcaa       420
     cgaactatta tgaaattgga ccaaatgatc gaaacgctag agtcttcgtc gaacgacgcc       480
     gatttgaaaa ctccgaaaag gacgctgggg gagacagatc ttggccaaaa ctcttgccct       540
     cttagaagag tcagagcacg gtgtaagaat ggggaagcct tgcttgatac gacttctgaa       600
     aaagcaccac aacatgttga gctacaagac aaaccattta cctctttcga gttacagcca       660
     gcatatgaag ctgtggacat gttcgcacct ctattgttcc acgattgtcc cccgccgcct       720
     actgataact ttgaccctcc cttttttgaa gcctcctcat cagtgggcta caggacacag       780
     ttgggtgacg gagaccctgt cggtttttgc gctgatatca ccgatccgat tcctgagact       840
     gaatttcgct ttgcgtggga tgaaaacaac ttccgaccca ctaccccaca atttcacgac       900
     cagaacatgc cggcccgcct tctcaccccc acttctgaac tgaaagatgt gccctggatc       960
     actgtggaat ttccggtacc gggcaagacc gcacgaagga aaaaaggtct tgaggattga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page