(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE11

PENCW_10.PE11        Location/Qualifiers
FT   CDS_pept        join(complement(28951..29113),complement(27558..27653),
FT                   complement(27279..27388))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128674"
FT                   /orf_name="Pc13g00110"
FT                   /product="Putative uncharacterized protein Pc13g00110 "
FT                   /protein_id="CAP91080.1"
FT                   /db_xref="UniParc:UPI0001830CFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G0"
FT                   /transl_table=1
FT                   /translation="MATTGWDRGLFMLETELCAGSGNEATLDNGEKSTGLRKEVTRLSS
FT                   MPQIGQQSGACPMTGAFADPIRETCLAPSPGNAFAVLAETLSQSPVEIVHANSLEKAKL
FT                   ASLATKHAMPRDQSTDNG"
     atggcgacga ctggctggga ccgaggatta tttatgctcg agactgaatt gtgcgctggg        60
     agcgggaacg aagctacatt agataatgga gagaaaagta ctggcctcag aaaagaggtg       120
     acaagactgt ctagcatgcc acagattgga cagcaaagcg gggcttgccc tatgactggg       180
     gcatttgctg atcctatcag agaaacatgc ttggctccgt ctcctggcaa tgcgtttgct       240
     gtgctagcag agacactcag ccagagtcca gtcgaaattg ttcacgccaa ttccttggag       300
     aaagcaaagc tggcatcttt ggctaccaag cacgcaatgc caagagatca atcaactgat       360
     aatggatag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page