(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE110

PENCW_10.PE110       Location/Qualifiers
FT   CDS_pept        join(complement(259844..260168),complement(259558..259783),
FT                   complement(259323..259344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948731"
FT                   /orf_name="Pc13g01100"
FT                   /product="Putative uncharacterized protein Pc13g01100 "
FT                   /protein_id="CAP91179.1"
FT                   /db_xref="UniParc:UPI0001830440"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L8"
FT                   /transl_table=1
FT                   /translation="MPRLQLPSNRSPGLSLIFKDYAMNQMKGTFDSSTTPNNLRLSWLT
FT                   KALRYTQEEAEESLERLHISTIERLGSLDDMIMGGLVDQPLTEIDIKNETILMVSWHWD
FT                   KCCDGSCPYSNRVTPLIRKSKRSLSKRPCAPIFQRKRSHRRRNIAQRKAIMKEKRRCRR
FT                   LRSIRLTLYTGRLLARRYWFYYSNILP"
     atgcccagat tgcaattgcc ttcaaatcga tcccctggtc tatccttgat attcaaagac        60
     tatgcaatga accagatgaa agggaccttt gattcgtcaa caacacccaa taatctccgt       120
     ctctcgtggc ttacgaaggc actccgttat acccaagaag aagcagaaga gagcctcgaa       180
     cgtttacata tctccactat tgagcggttg ggttcactcg atgatatgat catgggtggc       240
     ctggttgacc agcctttgac agagattgat atcaaaaatg aaaccatcct gatggtttct       300
     tggcattggg acaaatgctg cgacggaagt tgcccgtata gcaaccgcgt tacgcctcta       360
     atacggaaat cgaaacgctc cttatccaaa aggccatgtg caccaatctt ccaaaggaag       420
     aggagccatc gccggcgaaa cattgctcag agaaaggcta tcatgaagga aaagagaagg       480
     tgccgccgac ttaggagtat ccgattgacg ctctacactg gaagactttt agccagaaga       540
     tactggttct attacagtaa catcctccct taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page