(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE111

PENCW_10.PE111       Location/Qualifiers
FT   CDS_pept        join(260191..260266,260355..260428,260513..260644,
FT                   260928..261041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948732"
FT                   /orf_name="Pc13g01110"
FT                   /product="Putative uncharacterized protein Pc13g01110 "
FT                   /protein_id="CAP91180.1"
FT                   /db_xref="UniParc:UPI0001830441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L9"
FT                   /transl_table=1
FT                   /translation="MTAERRKLACICYVADDWRKLESTAVRTISFHRLGEMPCCEPIMS
FT                   GHGLPDQPLTRIFVPDPGRFGLKRKGSVTPIGYRLKHLARCCISDKGPQPVYVRPAILA
FT                   SPHIYGRDRASPMENTGIFDHRDASTY"
     atgactgcgg agaggaggaa gttggcgtgt atttgttatg tcgcagatga ctggcgtaaa        60
     ttggagagca cagcagtccg gaccatatct ttccacagac taggcgagat gccttgttgc       120
     gaaccgatca tgtccggtca cggtcttccg gaccaaccgc ttacaaggat cttcgttccg       180
     gatcctggga ggttcggcct gaaaaggaaa ggttcggtaa cacctattgg ctatcggctg       240
     aagcaccttg cccgatgttg catttctgac aaggggcccc agccggttta tgtgcgcccc       300
     gcgattcttg ccagccctca catatatggt cgtgatagag cgtcgccaat ggagaataca       360
     gggatattcg accatcgcga tgcatccact tattga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page