(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE112

PENCW_10.PE112       Location/Qualifiers
FT   CDS_pept        join(complement(262609..262753),complement(262476..262544),
FT                   complement(261640..262418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671900"
FT                   /orf_name="Pc13g01120"
FT                   /product="Pc13g01120 protein"
FT                   /protein_id="CAP91181.1"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniParc:UPI00018304FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M0"
FT                   /transl_table=1
FT                   /translation="MNILDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDIYRA
FT                   SEAEKTRPEWWPLGVMHKEPDHLRKEYRIGLLLHIIRKLGPYGITANKLKDVAGDTERS
FT                   LKHPSDVEIIYEILQVRKMEERLERGEADANMIVYITSRGPSREDDKEDGSAISVATEE
FT                   PEHINLELMNPIPSFEQASTSLNTPTDSIPSACSLPGRFSKAEPLNFQNPAYDPPSYAK
FT                   PQQYSDSSSEPMLSTPMAAEIISPHNASALAFDYSAQTYPNSTSGVTGHYDNWTPYFRQ
FT                   NIFSPIDYATPVSSQGMPHVNELPVSHRRAHLPNMDTIHQRSLFLRTEP"
     atgaacatct tggacacctt ggacaccttg gacaccttgg acaccttgga caccttggac        60
     accttggaca ccttggacac cttggacacc ttggacacct tggacacctt ggacaccttg       120
     gacatttatc gagcctcgga agcagaaaag accaggcccg agtggtggcc tctcggtgtt       180
     atgcacaagg agcctgacca cttgagaaaa gagtaccgca ttgggctctt gcttcacatt       240
     atccgcaaac tcggtcctta cggcattact gccaataagc ttaaggatgt tgctggcgac       300
     actgagcgga gcttgaagca cccatccgat gtcgagatca tttacgagat cctccaggtt       360
     cgtaagatgg aggagcgttt agaacgaggt gaagccgacg ccaacatgat cgtctacatc       420
     acgagccgcg gccctagtcg tgaggatgat aaagaagacg gttccgccat ctcagtggct       480
     actgaggagc ccgagcacat caacctagaa ttaatgaacc ctatcccatc attcgagcaa       540
     gcatctacct ccttaaacac acctactgac agtatcccat cagcctgctc tctcccaggc       600
     aggttctcta aggcggagcc tctcaacttc caaaaccctg cctacgatcc cccctcctac       660
     gccaagcctc agcaatactc cgattcatcg tcagagccca tgctcagcac ccccatggca       720
     gcagagataa tcagcccgca caacgcctca gccttagctt tcgactactc cgctcaaacc       780
     tacccgaatt ccacttcagg agtaaccggt cactatgaca actggacacc gtatttccgt       840
     cagaacatct tcagccctat cgactacgct acaccggtat ctagccaggg tatgcctcat       900
     gtcaatgaac taccagtttc ccatcgccgt gcccacttac ccaacatgga caccatccac       960
     cagagatctc tgtttttacg cacagagccc taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page