(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE113

PENCW_10.PE113       Location/Qualifiers
FT   CDS_pept        join(complement(265326..265400),complement(265081..265284),
FT                   complement(264516..265047),complement(264238..264463),
FT                   complement(263715..264172),complement(263108..263661))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977830"
FT                   /orf_name="Pc13g01130"
FT                   /product="Pc13g01130 protein"
FT                   /protein_id="CAP91182.1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI00018304FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M1"
FT                   /transl_table=1
FT                   /translation="MPMIKLRRSAARSSDHLEIKRGYLKKAEDLTRGELRELTTHDEYT
FT                   VYFGCHYFTIHDSPCTVYGESWHTPCQKTVDRPTGLCTLYGKYALNFLIGIVSNRNSTS
FT                   DYDDDMKRAKSLGIDAFALNIGTDPYTDQQLQLAYDSAADNDMKVFLSLDFNWWHIEQA
FT                   AEVGQKVAQYASKPAQLLVDDKVFVSSFAGDGMNVAEMRVAVGKSVFFAPNFHPSTGID
FT                   ITPVDGLLNWMAWPNNGNNKASTAEHSISVADGDKEYVDALGGKAYIAPVSPWFFTHFG
FT                   PEVSYSKNWNFPSDLLWFNRWNEILELKPRFIEIVTWNDYGESHYIGPLSSPHTDDGAS
FT                   KWVNDMPHEGWLDISKPYIAAFKAGQSSPDSHISSDELVYWYRPAPRGVNCDSTDTCMV
FT                   PANNDSGNYFMGRPDGWESMADSVFIVSLLTAPATVQVNSGGTVHNYEAPAGASAKEVP
FT                   MGVGAQSFEVNRDGETILSGTSLKEVIDGCVCGLYNFNAYVGTLPPGSNDVLQPEGLSA
FT                   FTQGLRVQTCQPTPSLGTVPPPAPSLSKSTILPSSPPGVTKAPEPCSAILSTVVTVTVT
FT                   EAMAPPNSPPTRTCGGGGGEGGGGRNRACIAGTGANNYSGLCSFCCSYGYCPSGPCTCT
FT                   NYGTPIPLPPSTGARGAPLIGEDDSYLGLCSFACDHGYCPPTACRIA"
     atgccgatga ttaaacttcg taggtcagct gcgagaagct ccgatcacct ggagattaaa        60
     aggggctatt taaagaaagc ggaagatttg acccgaggtg aactaagaga acttacaacc       120
     catgatgaat atacggttta ttttgggtgt cattacttta ctatccacga tagtccatgc       180
     actgtctacg gggaatcatg gcatacgccg tgccaaaaga cagtcgacag accgactggt       240
     ctttgcacac tttatggtaa atatgccctc aatttcctta tcggaatcgt cagtaataga       300
     aacagcacat cggactacga tgacgacatg aaaagggcta agtctctggg cattgatgcg       360
     tttgctctga acattggcac agatccctat actgatcaac aactccaact ggcatacgat       420
     tcggctgccg ataatgacat gaaagtcttt ctatcactcg atttcaactg gtggcatatt       480
     gaacaggccg ccgaagttgg ccagaaggtt gcccagtatg ctagcaaacc tgcacaactt       540
     ctcgtcgatg acaaggtatt cgtttcatcg ttcgctggtg atggaatgaa tgttgcagaa       600
     atgcgagtag cagttggaaa atcggtcttt ttcgcaccga atttccaccc atcaactggg       660
     atagatatca cgccagttga cggcctcttg aattggatgg cgtggccaaa caacggaaat       720
     aacaaagcct caactgcaga gcacagtatt tctgtcgccg atggggataa ggaatatgtc       780
     gatgctcttg gcggaaaggc ttatattgcc cctgtttccc cgtggttttt cacgcatttc       840
     ggacccgaag tttcttatag caaaaactgg aatttcccgt ctgatctcct gtggtttaac       900
     agatggaatg agattcttga gttgaaaccg cgatttatcg agattgtcac atggaatgac       960
     tacggagagt ctcattatat tggtcctttg agctcaccgc acactgacga tggggcctca      1020
     aaatgggtta atgacatgcc ccacgaagga tggctggaca tttcaaaacc atacatcgcc      1080
     gcgttcaaag caggccagtc gtctccagac agtcatatat catctgatga gttagtctac      1140
     tggtaccgac ctgcaccacg tggggtgaac tgcgactcta cagacacctg catggtacca      1200
     gcgaacaatg acagtgggaa ctatttcatg ggtcgtccag atggctggga atccatggct      1260
     gactctgtct tcattgtatc attgcttaca gccccagcca cagtgcaggt caacagcggc      1320
     gggactgtcc ataattacga agcgccagcc ggggcaagtg caaaggaggt gccaatggga      1380
     gttggtgcac aaagctttga ggtcaatcgc gacggcgaga ccattctgtc agggaccagt      1440
     ttgaaggagg ttatcgacgg gtgcgtgtgt ggtttgtata acttcaacgc ctacgtcgga      1500
     acgcttccac caggatccaa tgatgtcctc cagccagaag ggctctctgc cttcacacag      1560
     ggcctgcgtg ttcagacatg tcaacctacc ccctcattag gtacagtacc tccacctgct      1620
     ccatctctaa gtaagagcac catattgcca agttctcctc cgggcgtaac aaaagcccct      1680
     gaaccatgct ctgctatttt gtcgactgtt gtcactgtga cagttaccga ggctatggct      1740
     ccaccaaatt cacctccaac cagaacttgc ggcgggggcg gaggagaagg gggcggtggt      1800
     aggaataggg cctgcattgc aggaacagga gccaacaact acagcgggtt gtgttcgttt      1860
     tgttgcagct atggttactg tccatctgga ccctgcactt gtacaaatta tggaactcca      1920
     atcccgcttc caccatcaac tggagctcgt ggggcgcctc ttatcggcga agacgactcg      1980
     tatctgggtc tttgcagttt tgcatgtgat catggatatt gtccccctac agcctgcaga      2040
     atagcttga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page