(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE114

PENCW_10.PE114       Location/Qualifiers
FT   CDS_pept        join(complement(266620..266739),complement(266287..266487))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824603"
FT                   /orf_name="Pc13g01140"
FT                   /product="Putative uncharacterized protein Pc13g01140 "
FT                   /protein_id="CAP91183.1"
FT                   /db_xref="UniParc:UPI00018304FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M2"
FT                   /transl_table=1
FT                   /translation="MTSVGKTIANVSHERNRVREQEAKPSGSFIPTPKRAIQEQGPDHD
FT                   YDFGTAHKAKTVLPVFVLRQHGKRPDWVLIRWPQGDEPLGAQLADLHNALPRPNAPIRK
FT                   EI"
     atgacgagtg ttgggaaaac aatagcaaat gtatcccacg aaagaaatag agttagagag        60
     caagaggcca agccttccgg atcttttata cccacaccta agagagccat ccaggaacag       120
     ggcccagatc atgattatga tttcggcaca gcgcacaaag ctaagaccgt tttgccagtc       180
     ttcgtacttc ggcagcacgg gaaaaggccg gactgggttt taatcaggtg gccccaagga       240
     gatgaacctc ttggtgcaca gttagcggat ctccacaatg ccctcccccg cccaaacgct       300
     ccgataagaa aggaaatttg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page