(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE115

PENCW_10.PE115       Location/Qualifiers
FT   CDS_pept        join(266741..267477,267712..267882,267933..268036,
FT                   268088..268113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128948"
FT                   /orf_name="Pc13g01150"
FT                   /product="Putative uncharacterized protein Pc13g01150 "
FT                   /protein_id="CAP91184.1"
FT                   /db_xref="UniParc:UPI00018304FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M3"
FT                   /transl_table=1
FT                   /translation="MAPQIPEEDHCGHYFETFTQEITSDCGCLETPRENVKGNASCIIS
FT                   KFKFAQTPTCLSLGLIMIGIVGARLFVNCMSQDESHYHHLEGENGGLEDAVTVIENIFA
FT                   ADRQSMEECGLQPGEFKILDKAIISQYSDKDEQILRAETVVYCHIEKVSEKFNNSPNAI
FT                   IEKLFASGWVELEKVDSPLESRCELNREKLGMPETRIASIYKAFILVKCLVEGKHLYYT
FT                   GGSRADSRFANPQAFGVKPALGFSPSLMYLDKEEKRDPYIQSSGLYCDKSLDFGERVST
FT                   PDDFKSFVKWATVPRSKTVVETWNKRESKYKIVEPIDTSDELDDDAGYVFVARKRVDRA
FT                   PSERR"
     atggctcccc aaattcctga ggaagatcac tgcggacatt atttcgagac gttcacccaa        60
     gagatcacca gcgactgcgg gtgccttgaa actcctcggg agaatgtcaa gggcaatgca       120
     tcgtgcatca tttcgaaatt taagtttgcc caaactccca cctgccttag ccttggcctc       180
     atcatgatag gcattgtcgg tgccagatta ttcgttaatt gcatgagtca agatgagtcg       240
     cactatcacc atttggaagg cgaaaacgga ggtttggagg atgctgttac ggttatcgaa       300
     aacatattcg ccgcggatcg gcagtcaatg gaagaatgcg gccttcagcc aggcgaattt       360
     aaaatcctgg ataaggctat catttcccaa tattcggata aagacgagca aattctccgg       420
     gctgagaccg tggtgtattg ccacatcgag aaagtctccg aaaagttcaa caacagtcca       480
     aacgccatta tagaaaaatt gttcgcatct ggctgggtgg agctggagaa ggttgactcc       540
     cctcttgaaa gccgttgcga actcaacaga gagaaactcg gtatgccaga aacaaggatt       600
     gcaagcatat acaaagcctt cattctggtc aaatgtctcg ttgaaggcaa acatctctac       660
     tatactggag ggtcgcgtgc agattcacgc tttgcaaacc cccaggcctt cggtgtcaag       720
     cctgctctgg gattcagccc tagcctgatg tatctagata aggaagagaa gagggatcca       780
     tatatccaaa gttcaggcct ttactgtgac aagagcctag actttgggga aagagtgtcc       840
     actccagatg attttaaatc atttgtgaag tgggcaaccg tcccccgatc caaaacagtc       900
     gtggaaactt ggaacaaaag ggaatccaaa tacaagatag tcgagccaat tgacaccagc       960
     gatgaactgg atgacgatgc tggatatgtc tttgttgctc gcaagcgcgt tgaccgagcg      1020
     cctagcgaga ggcgttag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page