(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE116

PENCW_10.PE116       Location/Qualifiers
FT   CDS_pept        join(270126..270150,270180..271450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948733"
FT                   /orf_name="Pc13g01160"
FT                   /product="Pc13g01160 protein"
FT                   /protein_id="CAP91185.1"
FT                   /db_xref="UniParc:UPI00018304FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M4"
FT                   /transl_table=1
FT                   /translation="MKRVVRKIVKILSSRRFHVTYHLLCRWQTGLEFFLYQLCKTTAPG
FT                   LIDDCHWSCAEAAELTRLSEKVTEFFCFHHKPIFKDCGISEQERESFCSDLQEIRQIRH
FT                   CAVHRVDINAATINKYAKCALHVLGTIKRLGGQGFRKDHGEAVCPVPFPSHYNNRSPRH
FT                   ELQLDRFVNSFWETERHLILQASSHISPSQHEEQNPGHNSKKAEGARLREAQQDDAQPT
FT                   KAKEAEHSQKHHDDAQPTKAKKAEHSQKQQDDAQLKKAKKAEHSQQQQDDAQLKKAKKT
FT                   EHSQKQQDDAQLKKAKKAEHSQQQQDDAQPTKAKEAEHSQKHHDDAQPTKAKKAEHSQQ
FT                   QQDDAQLKKAKKAEHSQKQQDDAQLKKAKKAEHNQQQQDDAQLKKAKKAEHSQKQQGDA
FT                   RPKKYMRTVNIQKICASSNMCKGKSTICTHTT"
     atgaaacgcg tagtgcggaa gatagtgaaa atactaagtt cgcgtaggtt tcacgtgacc        60
     taccatcttc tgtgccgatg gcaaactgga ttggagttct tcttgtatca gttgtgcaag       120
     acaacagctc ctgggcttat tgatgactgc cattggtctt gcgcagaagc tgcagaatta       180
     actcggcttt ccgaaaaagt aaccgaattc ttttgttttc atcataagcc aatctttaaa       240
     gattgcggta tatcagagca agagcgagag tcattttgct ctgatttgca agaaattcgg       300
     caaatccgtc attgtgctgt tcatcgagtc gatataaacg cggcaaccat caacaagtat       360
     gcgaaatgcg cactccatgt gctaggcact attaaacgtc taggagggca aggcttcagg       420
     aaagatcacg gcgaagcagt atgtccagtt ccatttccct ctcactacaa taatcgctca       480
     cctcggcatg agttgcagtt ggaccgcttc gtcaatagtt tttgggaaac agaaaggcat       540
     cttatattgc aggcgtcttc tcacatttct ccttctcagc atgaagagca aaatcctggt       600
     cataattcaa aaaaggcaga gggcgcaaga ttgagagaag cccagcaaga tgacgctcag       660
     cctacaaaag ccaaggaggc tgaacacagt caaaagcatc atgatgacgc tcagcctaca       720
     aaagcgaaga aggccgagca cagtcaaaag cagcaagatg acgctcagct caagaaagcc       780
     aagaaggctg aacacagcca acagcagcaa gatgacgctc agctcaagaa agccaagaag       840
     actgaacaca gtcaaaagca gcaagatgac gctcagctca agaaagccaa gaaggctgaa       900
     cacagtcaac agcagcaaga tgacgctcag cctacaaaag ccaaggaggc tgaacacagc       960
     caaaagcatc atgatgacgc tcagcctaca aaagcgaaga aggctgaaca cagtcaacag      1020
     cagcaagatg acgctcagct caagaaagcc aagaaggctg aacacagtca aaagcagcaa      1080
     gatgacgctc agctcaagaa agccaagaag gctgaacaca atcaacagca gcaagatgac      1140
     gctcagctca agaaagccaa gaaggccgaa cacagtcaaa agcagcaagg cgacgctcga      1200
     cccaagaaat atatgcgcac agttaatatt cagaagattt gtgcatcctc caatatgtgc      1260
     aagggaaaaa gcacaatctg cactcataca acttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page