(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE117

PENCW_10.PE117       Location/Qualifiers
FT   CDS_pept        join(complement(273155..273482),complement(272976..273100))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948734"
FT                   /orf_name="Pc13g01170"
FT                   /product="Putative uncharacterized protein Pc13g01170 "
FT                   /protein_id="CAP91186.1"
FT                   /db_xref="UniParc:UPI00018304FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M5"
FT                   /transl_table=1
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKRNYLLREYRSMQESLSETT
FT                   SSGAVPLRAQRDEARMSCLPSLPIYAPRGSRTKTRILIHALEQLAVSERRHLTNDSDNA
FT                   NERLPGYTIQPPHTLRPAPSRHISYHWKFVHRMAAATRASRNAEIL"
     atgtcttgga aggaaaggtc cagggcatac ctcaggcagt tcggcgtgaa acgaacgggc        60
     gaggcattaa ggtgcaaacg aaactacctg ttacgggaat atcgctccat gcaggaaagc       120
     ctgtctgaga ccaccagctc gggggcagtt ccgttacgag cccaacgcga cgaagctcgg       180
     atgtcctgct tgccgtcgct tccaatctac gcacctagag gctcccgcac aaaaactcgc       240
     attttgatcc atgcgttaga gcagctggct gtttcagaac gccgccacct gacgaatgac       300
     tcggataacg caaacgagag actaccaggt tatacgatcc aaccgccaca cactctgagg       360
     cccgcaccct cgcgacatat ttcgtaccac tggaagtttg tacatcgtat ggcagctgct       420
     acgagagcgt cgcggaatgc tgagatctta tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page