(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE12

PENCW_10.PE12        Location/Qualifiers
FT   CDS_pept        join(29153..29324,29378..29922)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128675"
FT                   /orf_name="Pc13g00120"
FT                   /product="Putative uncharacterized protein Pc13g00120 "
FT                   /protein_id="CAP91081.1"
FT                   /db_xref="UniParc:UPI0001830CFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1"
FT                   /transl_table=1
FT                   /translation="MRSFNYLLLIGNVVAGSYLAIIEDNDGENNCRVWSQNNHGCTGYS
FT                   ATFAKLKGKDCSGFIGAGSDDKSVKVDICGTENGEQVAWVTVNKNGTVSFLNRQGDTSS
FT                   CMLENGLKVPSGCSIGNTGSSQTTTPISTASQSSFSTAIGTSTSGTARVDQSPTPTSTS
FT                   TPTDSPSFISDGKSATETPRADQSPTPIFTSTPTDSPSLDLISAGKSATGISLADHSPT
FT                   LTSTPACKCSCESAAV"
     atgcgttcct tcaactacct tttacttatc gggaatgttg tggcaggcag ttatttggct        60
     attattgagg acaatgacgg cgagaacaac tgtagagtgt ggtctcagaa taaccacggc       120
     tgtacaggct actcagcaac ctttgctaag ctgaaaggca aagattgctc gggtttcatt       180
     ggtgccggtt ccgacgataa gtcggtgaaa gttgatatat gtggcactga aaatggagag       240
     caggttgcct gggtgacagt caacaaaaac ggcactgtgt ctttcctcaa ccgacaggga       300
     gacacgtcta gttgtatgct agaaaacggt cttaaggtgc ccagtgggtg tagcattggt       360
     aatacaggtt cctctcagac gaccacgccg atctctacag ccagtcagtc ctcgttctca       420
     actgcaatcg gcacgtccac ttctggaaca gcccgtgtag atcaatctcc aacaccgaca       480
     tccacgtcga cgcctacgga cagtccatct tttatttcag acggtaaatc ggctactgag       540
     acgccccgtg ctgatcaatc tccaaccccg atattcacgt cgacgcctac agacagtcca       600
     tctttggatt taatttcagc cggcaaatcg gctactggga tatcccttgc agatcactct       660
     ccaactctca cgtctacccc ggcatgcaaa tgctcttgcg aatctgcagc cgtctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page