(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE120

PENCW_10.PE120       Location/Qualifiers
FT   CDS_pept        join(complement(278221..278376),complement(277592..278041))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948736"
FT                   /orf_name="Pc13g01200"
FT                   /product="Putative uncharacterized protein Pc13g00520 "
FT                   /protein_id="CAP91189.1"
FT                   /db_xref="UniParc:UPI0001830502"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /transl_table=1
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
     atgccttccc gtaggacgac atccgaagcc ccagctgatg ctggtcatgg cagttccgag        60
     tcagatgctg ctccaaaacg gactcgacgc cctcccagca ccggtcatgg tggccctccg       120
     tcaggcaccc aaggtgcatc cctccataca cccttgcgac tagaggcgga caaaacccaa       180
     gccacggcaa agattcgcca gctgagtgac accaatgacc agaatctggc caggattcaa       240
     acacttgagt tccaaatatc cagtctgaaa caacaacaac tcgacgctgt acaggttggt       300
     aacacagcca gtgataatct gttgcccata ctactggagg tcagcggcaa ttttcaatat       360
     gcgcagagcc agctggagaa gaagatagag gcagagaaaa ccgcagagaa aaacaagctt       420
     acatttgctg gcttccctgc ttctgatgtg ctacaacctt cctggccggt gtataacggc       480
     cagatgggtt cgcttggtac caactcgctt caaagctatt cacttccgtt gaccaatcaa       540
     caagcgccaa cacaagccaa ccaccaaccg ctcccgacag ctagccaata tataccgcag       600
     ttttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page