(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE121

PENCW_10.PE121       Location/Qualifiers
FT   CDS_pept        join(281390..281521,281569..281826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948737"
FT                   /orf_name="Pc13g01210"
FT                   /product="Pc13g01210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91190.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830503"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M9"
FT                   /transl_table=1
FT                   /translation="MTENTPLWAIEEGSSSQSQIPRPPVEKRRNVSLACIECRQKRIKC
FT                   SGTTPCANCTAKGCQCFYGSDRRRKAHSIESSMLHQALLYTVVKLRSGNPDTVRSFVLQ
FT                   IRALQSARDGTSFLLSESRQDDQAV"
     atgacagaaa acaccccctt gtgggcgatt gaggaaggtt catcttcgca atcacagata        60
     ccacgtccac cagttgaaaa gcgacggaat gtctctcttg cttgcataga gtgtcgccaa       120
     aagcgaatca agtgttctgg tacaactcca tgtgcgaact gtaccgcgaa aggttgccaa       180
     tgtttctacg gcagtgatcg cagacgcaaa gctcatagca ttgagtcgtc tatgttgcat       240
     caagcactgc tctacaccgt ggtcaaactc cgctctggaa acccggatac cgtgaggtca       300
     ttcgttttac agatccgagc cttgcaaagc gctcgagatg gaacgagttt tctccttagt       360
     gagagcagac aggatgatca ggctgtctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page