(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE122

PENCW_10.PE122       Location/Qualifiers
FT   CDS_pept        join(282432..283111,283167..284121)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948738"
FT                   /orf_name="Pc13g01220"
FT                   /product="Pc13g01220 protein"
FT                   /protein_id="CAP91191.1"
FT                   /db_xref="UniParc:UPI0001830504"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N0"
FT                   /transl_table=1
FT                   /translation="MSPSTQSPSNASQCVAPSSVDSDGLKKFLKLVSMLASSPESQTMS
FT                   AILGEIAYQREQVHARDKELKKAQDQVLDLEERKRVTIEEMFAANEGEKAKQKDALDRV
FT                   ESLRASVNQKDKRLAEYSKEVQGLRQQVDSIKSSYSLELDKVSQSAKDISTLQQNLEEK
FT                   DKTIDRMKAAGSSLKSMFSSAQKKIEELEAEKACLDQALQASQGQLQTLQSFTVQQLEL
FT                   DENSIMASFSDLWVFASSEVFAILREDLDEEVLKVCLCLNPNPLYNHIHSSFDQKDKSI
FT                   WDKLRKENTKIAENNIPLVPSNSLEAKGMRLAMTMAFLSRELCKYIFQPNYLFPDDSEI
FT                   RGVLSHLAENNTEKESFCRRVLLSIDHSAEEKIRQTRIQTVIRNVSSYLWALLSQTQHD
FT                   SIRISIEKIVQKAAGFWLPIQRAQQRYETEFELADFEIADCEPFHFPGDSALPDRQDQG
FT                   ARDMNVLTVFPCITLVKDGDRDPLTHLIQLRSSQKLFVAAEHEASQMTTSFVVPRRSST
FT                   RSRRKSIAHNTDRPNGASFLGGKSPQP"
     atgtctccca gcacccaaag cccttcaaat gcaagccaat gtgttgcacc ttcatcagtt        60
     gacagcgatg gccttaagaa atttcttaaa ctagttagta tgctggcttc aagtcctgaa       120
     tcccaaacca tgtccgccat tcttggagaa atcgcctacc agcgggaaca agtccacgct       180
     agagacaaag agttgaagaa agcccaagac caagtgctcg atctagagga gagaaagcga       240
     gtcactatcg aggaaatgtt tgccgccaat gagggcgaaa aggcaaagca aaaagacgct       300
     cttgaccgcg tcgagtcact tcgtgcatca gttaaccaga aagacaaacg tcttgccgaa       360
     tactccaaag aagtacaagg tctccgccag caggtagaca gcatcaagtc atcatactca       420
     ttagaactcg acaaagtttc tcaatcagcg aaggacatca gcacactcca acagaattta       480
     gaagagaaag acaagacgat tgacaggatg aaggctgctg gatcaagtct aaaatcaatg       540
     ttttcatcag cgcagaagaa gatagaagag ctggaagctg aaaaagcctg tttggatcaa       600
     gcactacaag cgagccaagg ccaactccaa accctacaaa gctttactgt tcagcaattg       660
     gagctagacg aaaattcaat aatggccagc ttttcagatc tatgggtctt tgcttcaagc       720
     gaggtattcg ccattttgag agaggacctt gatgaggaag tcttgaaggt atgcctctgt       780
     ctgaacccca acccgcttta taaccatatc cactcatcgt tcgaccaaaa ggacaaatcg       840
     atctgggaca agcttcgaaa agaaaatact aaaattgcag aaaataatat tcctctggta       900
     ccttcaaact ctctcgaggc taaaggaatg cgtctagcta tgacaatggc ctttctgtcg       960
     agggaacttt gcaaatacat tttccagcct aattaccttt ttccggatga ttctgagatc      1020
     cggggagtcc tcagtcacct cgctgagaat aataccgaga aggaaagttt ctgccgacgt      1080
     gttcttctct cgattgatca cagtgccgag gaaaaaattc gccagacaag gatacagacg      1140
     gtgatccgca atgtatcgtc atacttgtgg gcattgcttt cacagaccca gcatgattcg      1200
     attcgcataa gtatagagaa aattgtccaa aaagcggctg gattttggct tcccatccaa      1260
     cgagctcagc agagatatga gacagagttt gagctggctg atttcgagat tgccgactgt      1320
     gagcctttcc atttccccgg agatagtgcg ctcccagata ggcaggatca gggtgctcga      1380
     gacatgaacg ttctcactgt gttcccttgt atcacgctgg tcaaagatgg cgatcgtgat      1440
     cccttaaccc accttattca attgaggagc tcacagaagc tttttgtggc agcagagcat      1500
     gaggctagtc aaatgacaac tagcttcgtc gtccccagga ggtcatcgac ccgctctaga      1560
     cggaagtcta tcgctcataa cactgatcga ccaaacggcg cctctttttt aggaggaaaa      1620
     tcgccacagc cgtga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page