(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE123

PENCW_10.PE123       Location/Qualifiers
FT   CDS_pept        join(285772..285774,285991..286290,286337..286798)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948739"
FT                   /orf_name="Pc13g01230"
FT                   /product="Putative uncharacterized protein Pc13g01230 "
FT                   /protein_id="CAP91192.1"
FT                   /db_xref="UniParc:UPI0001830505"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1"
FT                   /transl_table=1
FT                   /translation="MRVSKSFNSAFSSSVFGLGSGYSCFRRFLDHPGAFRRVLRCGAVV
FT                   TGPLVFQYFAKQYVDDVEIDILVSYDQSHTVTQHLQQSEGYEMVDEECSPFTETLKVSR
FT                   FKKERKTVRVSAIRNLTPLAFFLTHERTTACFNFLTEDYGYCLFPMSMRRKLDYRVCPV
FT                   LEEIEYGWLPEPQDGWTFYADFPHDGVTVSDHYAMVPVDMEIRTDRWIGDRFTWKVKLF
FT                   TDSPAEGVEKREYAFFVKSQSVHLGSWNETEQ"
     atgcgagtga gcaagtcttt taatagcgca ttttccagca gtgtcttcgg cctaggaagt        60
     gggtattcat gttttcgcag atttttggac catcctggag cttttcgacg agtgttgcga       120
     tgtggagctg tcgttacggg gccgttggtg ttccagtact tcgccaaaca atatgtggac       180
     gatgttgaga ttgacattct ggtttcttat gaccagagcc atactgttac acaacatctt       240
     caacaatctg aaggatacga gatggtcgat gaagagtgtt ctcctttcac agagactttg       300
     aaggtgtcga gattcaaaaa agagagaaag accgtccgtg tatcggctat acgcaatttg       360
     acgcctcttg ccttcttcct gacccatgag cgaacaactg cttgtttcaa tttcctgaca       420
     gaggattacg gatattgctt gtttccaatg tcaatgaggc ggaagttgga ctatcgggtg       480
     tgtcctgtcc tggaagagat agaatatggc tggcttcctg aaccacagga tggatggacc       540
     ttttatgctg atttcccaca tgatggtgtg acggtatctg atcattatgc aatggttcct       600
     gttgatatgg aaatcagaac ggatcggtgg ataggggacc ggtttacctg gaaagtcaag       660
     ttgttcactg acagtccggc agaaggtgtt gaaaagcgtg aatacgcctt ttttgttaag       720
     tcacaaagtg ttcacctggg aagctggaat gaaacagaac aatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page