(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE124

PENCW_10.PE124       Location/Qualifiers
FT   CDS_pept        join(complement(287421..287570),complement(287100..287316),
FT                   complement(286905..286993))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128949"
FT                   /orf_name="Pc13g01240"
FT                   /product="Putative uncharacterized protein Pc13g01240 "
FT                   /protein_id="CAP91193.1"
FT                   /db_xref="UniParc:UPI0001830506"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N6"
FT                   /transl_table=1
FT                   /translation="MDLPWFYCADRCSDEEGTRGQSENEQTKERISGGGRSIKFLDPEY
FT                   SAESMVSPEDRTRIPTLIRFRLDAKSLKDQDLWNQGMQRKYIEMIGTIEALSKEAAALR
FT                   KQVEVLPSGDAVKTRETVGLISHGAPGYSNNDKRTPPTGKFKVHVNV"
     atggatctgc cgtggttcta ttgtgctgat agatgcagtg atgaagaggg aactcgggga        60
     caaagcgaga atgaacagac caaggaacgg atctcgggtg gaggcagatc cataaagttc       120
     ttggatcctg agtattccgc agagtcaatg gtttcccccg aagacaggac cagaatccca       180
     acactgatac gcttcagact tgatgcaaag tcgttgaagg atcaggacct atggaatcag       240
     ggaatgcagc gaaagtatat agaaatgatt ggtactatag aggcattgag taaagaagcg       300
     gccgccttac ggaaacaagt ggaggttttg ccgagcggag atgcagtcaa aactcgagag       360
     accgtggggt tgatctctca tggagctcca ggatatagta acaatgacaa gagaactccg       420
     ccaacaggaa agttcaaagt ccatgtaaat gtttga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page