(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE126

PENCW_10.PE126       Location/Qualifiers
FT   CDS_pept        join(289563..289610,289937..290024,290128..290312,
FT                   290405..290779)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948741"
FT                   /orf_name="Pc13g01260"
FT                   /product="Putative uncharacterized protein Pc13g01260 "
FT                   /protein_id="CAP91195.1"
FT                   /db_xref="UniParc:UPI0001830508"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N8"
FT                   /transl_table=1
FT                   /translation="MRPGTPFVLGLPPSASGVFNRKYKDIQPSQGIHLLSLVVNEAVHA
FT                   VYPSLFSPIPVFYNLDSDELWNPNKSMDSPPSPSQSGRANKRKRASPDQFVIPVGMPGR
FT                   SEQTIPAGAACSLTRNMSQILQSHPSLKSSSAVDLLDLYLCLWECYTIKSAGRIRLEEE
FT                   RRFLQDSNKWLVRENEKLQEYCNHQELLLWDHRQAFVSVHQGVLGTLQNSDRPSRQISE
FT                   LQWDRAGAN"
     atgcgtcctg gaacaccttt cgtccttgga ctacccccgt cagcatccgg cgtcttcaat        60
     cgaaaataca aggatattca accatcgcaa ggcatccact tactgagcct ggtggtgaat       120
     gaggcagttc atgcggttta cccgagcttg ttctctccta tccctgtttt ctacaatctg       180
     gatagcgatg agctttggaa tccaaataaa tcaatggact ctcctccttc tccgtctcaa       240
     tctggacgag ccaacaaaag aaaacgtgca tctccagatc agtttgttat ccccgttggc       300
     atgccaggga gatcggaaca gacaattccg gccggtgcag cctgttcttt gactagaaac       360
     atgtctcaga ttctacaaag ccatccttct ttaaagtcgt cctctgccgt cgaccttctc       420
     gacctctatc tgtgtctgtg ggagtgctac acgatcaagt cggccggcag aatacgcttg       480
     gaagaggaac gtcgcttcct gcaagactca aacaaatggt tggtgagaga aaacgaaaag       540
     cttcaagagt actgcaatca tcaagaactg ctgctgtggg atcatcgtca ggcctttgtc       600
     tctgtacacc agggtgttct cggaacacta cagaacagtg acagaccctc gcgtcagata       660
     agtgagctac aatgggaccg tgcaggagca aattga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page