(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE127

PENCW_10.PE127       Location/Qualifiers
FT   CDS_pept        join(291831..292588,292691..292769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948742"
FT                   /orf_name="Pc13g01270"
FT                   /product="Pc13g01270 protein"
FT                   /protein_id="CAP91196.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830509"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N9"
FT                   /transl_table=1
FT                   /translation="MSVQLDNHQSIINYCRSCPEDQLTGGLRSGNQVVKLPDCDLVVKF
FT                   GPFVSSYEAKNQQKAYGIINPDIVIVPSVHKFFVDDEGWGYIISDFIQGKIIEPLSDSH
FT                   IHRLAHILEYFRSITANRAGSLCGGPSVGLLFPDTNDLTISNVQQVEEWFNSRLFPGDG
FT                   KVHFDPTPLVLCHLDIAPRNVIWLDDGRVCLLDWASAGFYPRLLEFASLFFQEYRFSEM
FT                   LLKAVGFDYGRDKEEQQRICQALYNNERYSFWLHLSSSITSGTAKTSDLTRRKWYW"
     atgtctgttc aattagacaa tcaccagtca atcattaact attgccgctc ttgtccagag        60
     gatcagctta ctggaggctt gaggtctggt aaccaggtcg ttaagctacc agattgtgac       120
     ttggtagtca agttcggccc gtttgtctcc tcctatgagg caaagaatca gcaaaaagca       180
     tacggcataa ttaatccaga tatcgttata gtcccctcgg ttcataaatt ttttgtggac       240
     gatgagggtt ggggctacat aatatcggat tttattcagg gcaagattat cgaacctctc       300
     tcagactctc acattcacag actcgcccac attcttgagt attttcgctc tattaccgcc       360
     aatagggctg gtagcctgtg tggtggccct tcagttggct tgctcttccc agatacaaat       420
     gatctgacca ttagcaatgt tcagcaagtg gaagaatggt ttaacagccg actttttccc       480
     ggagatggta aggttcattt tgatcctacc ccactggtgc tctgtcattt agacatagcc       540
     ccccgaaatg ttatctggtt ggatgatggc cgtgtctgtt tactagactg ggcatcagca       600
     ggattttatc cgaggctgtt ggaatttgct agtctattct ttcaagaata tcgttttagc       660
     gagatgcttc tgaaagcagt cggttttgac tacggtcgtg ataaagaaga acagcagagg       720
     atctgccagg cattgtataa caatgaaagg tactccttct ggttgcatct ttcctcttcc       780
     attacttccg gaaccgcaaa aacttccgac ttgacgagga ggaaatggta ctggtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page