(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE128

PENCW_10.PE128       Location/Qualifiers
FT   CDS_pept        complement(295236..296234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948743"
FT                   /orf_name="Pc13g01280"
FT                   /product="Pc13g01280 protein"
FT                   /protein_id="CAP91197.1"
FT                   /db_xref="UniParc:UPI000183050A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P0"
FT                   /transl_table=1
FT                   /translation="MERIASGFGRYLPIAEANNLIRTALLNVPFTQDVQVAGIGTTKTG
FT                   YVIRFKDTASAEAARENNEWLRELGNETELVKPRFGAVVHHVPTEDWTSSETKKELFKR
FT                   SWKRTTSRNGGFRIEYIGSYARLPLAEALKTMSLERLQELEMIDPTPLPPWRTEAFSAI
FT                   EIEPDRETAIEQAKAAGSKSDVILYSDASGHNGHLGAAAIGFNKNSPEATESLQIQVGP
FT                   MDRWAVHAAEPLGVLQAITLINNIALKHRRSMDTRVKSATTLSDSMSDLQAIQNPGNKS
FT                   GQQIIHTILRAVTNTKTHGIAVRLQWVPVLYISRICTYIVSHFLKTNLEPR"
     atggaaagaa tagcgagcgg atttggtcga tacttgccca ttgccgaagc gaataacctt        60
     atcagaacag cgttgttgaa cgttcctttt acccaggatg tacaggttgc aggaatcggc       120
     actacgaaga ccggatacgt gatcagattc aaagacacgg cgtcagctga ggcggcgcgc       180
     gaaaataacg aatggctacg cgaactgggt aacgagactg agctggttaa accgcgattc       240
     ggggcagtcg tgcaccacgt accgacagag gactggacct cgagcgagac aaagaaagag       300
     ctattcaaaa gatcatggaa gagaacgacc tccaggaacg gcgggttccg aatcgaatat       360
     attgggtcat acgcgcggtt gccgcttgca gaggccctga aaacaatgtc cttggagaga       420
     ttacaagaac tggaaatgat tgatccaacc ccgctccccc cgtggcgaac tgaggccttc       480
     tcggcgattg agattgaacc cgacagagag accgcgatag agcaggcgaa ggcggcaggg       540
     tctaagtcgg acgtcatcct ctactcagac gcttcgggac acaacggtca tctcggcgca       600
     gcagccatag gattcaacaa gaactcaccg gaagcaaccg aaagcctaca aatccaggtt       660
     ggcccgatgg accgatgggc agtacatgct gctgaaccac tgggggtctt gcaggcgatc       720
     accctcatca acaacattgc cctcaaacat cgaagatcaa tggacacacg ggtcaaatcc       780
     gcgaccaccc tcagcgatag tatgtcagat ttacaagcaa tccagaaccc agggaacaag       840
     tctggacaac agattatcca caccatccta cgagcagtca cgaacaccaa aacccacggc       900
     atcgcggttc gtctacagtg ggtacccgta ctatatatat cccgcatatg tacatatatc       960
     gtgtcccact tcctgaaaac gaacttagag cctcgttaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page