(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE13

PENCW_10.PE13        Location/Qualifiers
FT   CDS_pept        join(complement(32363..32506),complement(31944..32303),
FT                   complement(31717..31900),complement(31132..31667),
FT                   complement(30973..31077))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128676"
FT                   /orf_name="Pc13g00130"
FT                   /product="Pc13g00130 protein"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAP91082.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001830CFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G2"
FT                   /transl_table=1
FT                   /translation="MHFILFLILSLAWLANATYIPSLVKVNAADIATRGVNGYRSVAYF
FT                   VNWGIFQPQDIPAEKLTHVLYAFANVRASGEVILSDPWSDTDKHYPTDSWTDTGNNVYG
FT                   CIKKLFLLKKKNRKLKVLLSIGGWTYSSNLRLAFETEAGRQKFAGSSVELLKDLGFDGI
FT                   DVDFEKYPGNNNEADQFVDTLRRLREVFSCFFYLWVCKTKHIQALDVYSYANTGGYHFL
FT                   LTAASPAGPANYLKEHLAQMDRYLDFWNLMAYDYAGSWDTVAGHGANLFASNSNPASTP
FT                   FNTDQAIDYYTSHGVASSNIVLGMPLYGRAFTDTSGPGQPYNGLGVGGWRDGVWDYKAL
FT                   PQTGCKVTNLDQEAASYCYSSGSRLFISYDTPEVARKKGEYIKSKGLGGGMWWELSGDK
FT                   QGDDSLITTVVSTLGGTGALDKTDNQLSYPISKYDNLKACFEP"
     atgcacttca tcctttttct aatattgagc ctggcgtggc tggctaacgc tacctatatt        60
     ccctccttgg tcaaggtcaa tgcggctgac attgctactc gtggcgttaa cggatatcgt       120
     tccgtggcat actttgtgaa ctggggcatc ttccaacctc aggacatccc agctgagaaa       180
     ctaacccatg ttctctacgc atttgccaat gtccgagcct ctggtgaggt gatcctgtcg       240
     gacccttggt cggacactga taagcactac cctactgatt cctggaccga taccggcaac       300
     aatgtctatg gctgtatcaa aaagcttttc ctactcaaaa agaaaaatcg caaacttaag       360
     gttcttctgt cgattggagg ctggacgtac tcttccaacc tcaggctggc ctttgaaact       420
     gaagcgggac gccagaagtt tgctggcagt tctgtcgagt tgctaaagga cttgggcttc       480
     gacggtattg atgttgattt tgaaaagtat cctggaaata acaacgaagc ggaccaattt       540
     gttgataccc tacgccgtct tcgtgaggta ttttcatgct tcttttattt atgggtctgt       600
     aaaactaaac atattcaggc cttggatgta tacagctacg ccaacacagg cggctatcac       660
     ttcttactca ccgctgcatc tcctgctggc cctgccaact acctgaaaga gcaccttgcc       720
     cagatggatc ggtatctgga cttctggaac ctgatggcct acgattacgc cggaagctgg       780
     gacactgttg ccggccatgg cgccaacctg tttgcatcca acagcaaccc agccagcact       840
     cccttcaata cggaccaagc aatcgattac tacacctcgc acggagtggc ctcttccaat       900
     attgttctag gtatgccgct gtacggccgg gcgtttactg acaccagcgg ccctggccaa       960
     ccttataacg gtcttggtgt tggtggctgg agggatggtg tgtgggacta caaagctctg      1020
     cctcagaccg gctgcaaggt cacaaatttg gaccaggaag ctgctagcta ctgctatagc      1080
     tcggggtcgc gtttgttcat cagctatgat acccctgagg ttgcgcgtaa aaaaggtgag      1140
     tacatcaaat ccaaggggct tggtggtggt atgtggtggg agcttagtgg tgacaagcaa      1200
     ggtgatgaca gtctgattac cacggttgtg agtactcttg gaggcactgg tgctctggac      1260
     aagaccgata atcagttgag ctatcctatt tccaaatacg acaatttgaa ggcctgcttt      1320
     gagccttga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page