(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE130

PENCW_10.PE130       Location/Qualifiers
FT   CDS_pept        complement(<300926..>301906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000136556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824604"
FT                   /orf_name="Pc13g01300"
FT                   /product="Pc13g01300 protein"
FT                   /protein_id="CAP91199.1"
FT                   /db_xref="UniParc:UPI000183050B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P5"
FT                   /transl_table=1
FT                   /translation="PAGAPEPLPTNTQESTSSFSIEDFQPRVTASSLGSLPDSRKRTRS
FT                   GDAFTPSESTGRATTREVWRLIDSLKTIIHHQTTLIESTEAELQEVKHDQNVLRDQNEN
FT                   LHEEVRALRTQIEILPQAAPTRSWATVAASGGVRPPQLTHQRPDKDQNCVRISTQRLLV
FT                   DPTDNHNGDRNTFGRYLPTDSANTHIRMALLSAPSTQYAEVAGIGTTKTGYVIRFKNPT
FT                   SAEAARNNTDWLNELGNSTKLVKPRFGVVVHRTPTEDFDLQNASQQAIEKIMDEDELTE
FT                   RGFRIEEVAWLKKKDKELGKFASLGIWFDSAEGAEWLLVNGLLVGQ"
     cccgcggggg ctcccgagcc cctccccaca aacacccaag aatcgacgtc cagcttctcg        60
     attgaagatt tccaacccag agtgacagcc agttcgctcg gttcgctccc cgatagccgg       120
     aagcgaacgc gaagcggcga tgccttcacg ccctcggaaa gcacgggccg ggccaccacc       180
     agagaggtgt ggaggctcat cgacagtcta aaaaccatca tccaccacca aaccacgctc       240
     atcgaatcga ctgaagccga actacaggag gtcaagcatg accagaatgt ccttcgcgat       300
     cagaatgaga atcttcatga agaagtcaga gcgctgcgaa cacaaatcga aatcctccca       360
     caggcggccc cgaccagatc atgggccaca gtagcggcca gcggtggcgt tcgtccaccg       420
     caactgacac accaacgacc cgataaagac cagaactgcg tcagaatcag cacccagcga       480
     ttgttggtag acccaaccga caaccacaat ggtgaccgaa acacctttgg ccgatacctc       540
     cccacagact ccgccaacac ccacatccga atggcgctat tgagtgcccc atccacacaa       600
     tatgccgagg ttgcggggat cggcaccacc aaaaccggat acgtgatccg gttcaaaaac       660
     ccaacgtcgg ccgaagcggc ccgcaacaac accgactggt tgaacgagct gggaaacagc       720
     acgaagttgg tcaagccacg attcggcgtt gtcgtccacc gtaccccgac agaggatttc       780
     gacctgcaaa atgcgagcca acaagctatt gagaaaatca tggacgagga cgaactgacg       840
     gagcgaggtt tccgaattga ggaggtggca tggctcaaga agaaagacaa ggaactaggg       900
     aaatttgcat cacttggtat ttggttcgac tcggcggagg gagcagagtg gctactggtc       960
     aatggcctcc tcgtcggcca g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page