(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE131

PENCW_10.PE131       Location/Qualifiers
FT   CDS_pept        complement(304368..305837)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948744"
FT                   /orf_name="Pc13g01310"
FT                   /product="Pc13g01310 protein"
FT                   /protein_id="CAP91200.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183050C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6"
FT                   /transl_table=1
FT                   /translation="MPLLGLPLEILLWVGKFTDEKGLRTLCLTSREFNVIFRKSLFDCI
FT                   DFQDSPPIHWAIEHRSLGILQHSLGWEKADINEMYSGFTPLMLATQLRYADAVDLLLSH
FT                   HSVKVIQCNTLGESAFSIAVLHGSVKIVERLLNVQNVDLNNQSLDGIAPISVALTCRQT
FT                   YVFQLLLSDERTNVNICDHHGQTPLHLATEIGDYGAIQMLVRNPRVDVNCFNHRQETPL
FT                   LLAVKGHGRFLPIHKRLLIIEALLLSPCLNLNYQDENGRTAIWYAVSNSDLKLVELLLQ
FT                   QTNLDLNCADKLGQTPLAKAAANGSLDLIKVLFRQPGLHKSPSPQFTDAFPPLWSACRA
FT                   GQFAAVEFLLQNSADINQISPSGTSPLEVAIIMEHVDIVHLLVSSEKSLLINDQNHCSS
FT                   FTALMFASALGKVEIVKILLEHPNINVNAVDDQGRTSFWWAAAGGHYEVVQLLANRRGV
FT                   KKRLKDSNGQTAYAIAEQRKHGHVMVYLRSL"
     atgccgcttt tgggacttcc actggaaatc cttctctggg ttggcaagtt taccgacgag        60
     aaaggccttc gaactttgtg tcttacgtct cgagaattta acgtcatctt cagaaagagc       120
     ctctttgatt gcatagactt tcaagattcc ccgccaattc actgggcgat cgaacataga       180
     agcttaggca tcctccagca ctctctgggt tgggaaaagg cagacatcaa cgaaatgtat       240
     tctggcttta cacctctcat gctggctaca cagttgcggt acgcagacgc tgttgatttg       300
     ctattaagcc atcattcagt gaaagtcata cagtgtaata ctttgggaga aagcgccttc       360
     tcgatcgcag tcctgcatgg aagcgtcaaa attgtcgaac gactcctcaa tgtacagaac       420
     gttgatctca ataaccaatc actggacgga attgcgccca tttcagttgc gctgacctgt       480
     cgccaaactt atgtcttcca acttctcttg tctgatgagc gaacaaatgt caacatctgc       540
     gaccatcatg gccaaacccc actgcaccta gcgacagaaa ttggcgacta tggagcaatc       600
     caaatgcttg tacgaaatcc tcgagttgac gtcaactgtt tcaaccatcg acaggaaact       660
     ccgttgcttc tggcagtcaa aggacacggc cgtttcctcc ccatccacaa acggctgctt       720
     atcattgaag ccttgctttt gagtccatgc ctcaacctta attatcaaga tgagaatgga       780
     cgcaccgcaa tatggtatgc ggtgagcaat tccgacctaa aattggttga gctcctcttg       840
     cagcaaacaa atctggacct caattgcgcc gacaagctgg gccagacacc tttggcaaag       900
     gctgctgcga atggctcctt agacttgatc aaagtcctct tccgacagcc ggggcttcat       960
     aagagcccta gccctcaatt taccgatgca tttccgccgc tctggtcagc atgtcgcgca      1020
     ggacagtttg cagcggttga atttctcttg cagaattcag ccgacattaa ccaaataagc      1080
     ccatcgggga cgtcgccact tgaggtcgca ataattatgg agcatgtcga cattgtccat      1140
     ctcctagtca gctccgaaaa atctttgctg atcaatgacc aaaaccattg ctcctccttt      1200
     actgcgctaa tgtttgcgtc ggctctaggc aaggttgaaa ttgtcaaaat attattggag      1260
     catcccaaca taaatgtgaa tgcggtggac gaccagggaa gaacatcttt ctggtgggca      1320
     gcggctggtg ggcattatga ggttgtgcag ttattggcca atcgacgtgg tgtgaaaaag      1380
     cgactgaaag attctaatgg ccaaacggcg tatgccatcg ccgagcagcg caaacatggg      1440
     catgtcatgg tttatttgcg aagcttatag                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page