(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE133

PENCW_10.PE133       Location/Qualifiers
FT   CDS_pept        join(309937..310111,310204..310327,310479..310554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671901"
FT                   /orf_name="Pc13g01330"
FT                   /product="Putative uncharacterized protein Pc13g01330 "
FT                   /protein_id="CAP91202.1"
FT                   /db_xref="UniParc:UPI000183050E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8"
FT                   /transl_table=1
FT                   /translation="MEMRPPTLSVQLLSPLLWPIKLVQSRCGSTEGSDPRNNSMVLTMW
FT                   RGGGLLVRNHTDTVYDGPGIEPAPDIENWDNKRIYVRVIEWTAGQSLRVEGKSGCADIV
FT                   GAFERTMMQVEIKQADQSEH"
     atggaaatga gaccacctac gttatcggtg cagcttctca gccctttgct gtggccaatt        60
     aaactcgttc aatctcgttg tggatcgact gaaggaagtg atcccaggaa caatagcatg       120
     gtgttgacca tgtggcgggg tggcgggctc cttgttcgga atcatactga taccgtatac       180
     gatggtcctg ggatcgagcc agccccggat atagagaatt gggacaacaa gcgaatctat       240
     gttagggtta ttgaatggac ggcgggacag agcctgcgtg ttgaagggaa gagtggatgt       300
     gcggatatcg tcggagcttt tgaaagaacg atgatgcaag ttgagatcaa acaggccgat       360
     cagtctgagc actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page