(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE134

PENCW_10.PE134       Location/Qualifiers
FT   CDS_pept        join(311236..311849,311904..312720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671902"
FT                   /orf_name="Pc13g01340"
FT                   /product="Pc13g01340 protein"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAP91203.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI00018305D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P9"
FT                   /transl_table=1
FT                   /translation="MGTLLPGKPLTALARCTRPTSNVNASMALRFTSTLQAHAQAKTAT
FT                   SPSLPPLSVLPARVLLRSLLVSTISSKRVLPIPALSLMSFLSKPNRIWLFDVDRNPVLH
FT                   GILKTTFYNQFCAGENGAECRSTIREMKDMGFRGMILTYAAETVFDHSTQAQSGQGVAA
FT                   LKSENGDVAVEASVHCPSIEAWREGTVETIYMTEAEDYIAVKLTGAGAKVTEAFTAGEL
FT                   PPHQMMDALHEVCTKAKDRKVRILIDAESQHFQKGISRVAVELMRKYNRDGYAAIYNTY
FT                   QAYLKNTPATLANHLALANEDGFTLGLKLVRGAYMATDERSLIHDTKEDTDNAYNMIAQ
FT                   GALRKNIGEFGDKGARDFPSVNLFLASHNKESVVTAHELHKNRVMSGLPTVPVRFAQLH
FT                   GMSDEVSFSLLQMNDGDGTPEVYKCSTWGGMGECLAYLLRRAIENRDAVLRTDNEYRAL
FT                   KKEVFRRVKSVLSLSPSS"
     atgggtacct tacttcctgg aaagcctcta acagctcttg cgcgatgcac tcgaccaacc        60
     agcaatgtga atgcctcgat ggcattgcga tttacctcaa cgctccaagc acatgcgcag       120
     gctaagactg ctacgagccc ctcactacca cctctctctg ttttaccggc gcgtgtccta       180
     ctcagatcgc tgttggtctc tacgatatcg tcaaagagag tcctccccat tcctgcgctt       240
     tcgttgatgt ccttcctctc caagcctaac agaatctggc tattcgatgt ggatcggaat       300
     ccagtcctac atggaatatt aaagactacg ttctacaatc aattctgtgc tggagagaat       360
     ggggcggaat gcagatccac catccgggaa atgaaagaca tgggcttccg cggtatgatt       420
     ttgacatacg ctgctgagac tgtgtttgat catagtactc aggctcagag tggacagggt       480
     gtcgctgctt tgaaaagcga gaacggggat gtggccgtcg aggcttcagt ccactgtccc       540
     agcatcgaag cgtggcggga agggacagtt gagaccatct acatgacgga ggcagaagat       600
     tacatcgcag tcaagttgac tggggctggc gccaaagtca ccgaggcttt tactgctgga       660
     gagttgcccc cgcatcaaat gatggatgca ttgcacgagg tctgcaccaa ggccaaagac       720
     cgaaaggttc gcatcctcat cgacgccgag tctcagcatt tccaaaaggg catttcacgg       780
     gttgctgtgg aacttatgcg taaatacaac cgtgacggtt acgcagctat ctacaatacc       840
     taccaggcct acctcaaaaa cacaccagcg acactggcca accaccttgc tctggcaaac       900
     gaagatggat tcactctcgg cctcaaactc gtgaggggtg catacatggc cacggatgaa       960
     cggtccttga tccatgatac gaaggaagac accgataacg catataatat gattgcccag      1020
     ggggcactga gaaaaaacat tggagagttt ggagacaaag gcgcccgcga tttcccctcg      1080
     gtgaatctgt ttctggcaag tcataacaag gagagcgtgg tgactgccca cgaactccac      1140
     aagaatcgtg tcatgtctgg cttgcccact gtgcctgtgc gttttgctca gcttcatggt      1200
     atgtccgatg aagttagctt ttctctgctt cagatgaatg atggcgatgg aacaccggaa      1260
     gtttacaaat gctccacctg gggaggtatg ggtgaatgcc tggcctatct tcttcgtcgg      1320
     gcaattgaga atcgggatgc tgttctgcgg acggataatg agtatcgggc attgaagaag      1380
     gaggttttcc ggagagtgaa gtcggtgctt tctctttcgc catcttcgta g               1431
//

If you have problems or comments...

PBIL Back to PBIL home page