(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE135

PENCW_10.PE135       Location/Qualifiers
FT   CDS_pept        join(313975..314170,314228..314410,314472..315646)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824605"
FT                   /orf_name="Pc13g01350"
FT                   /product="Pc13g01350 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91204.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018305D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0"
FT                   /transl_table=1
FT                   /translation="MAPKLKGKSLSLIIGLVGAVGFVLQGYDQAVANGLLTLGSFIAVF
FT                   PQIDTVHTSGSEKSHNSTIQGTTVAIYEVGCALGAGSCAFLGDRLGRRKTIFLAGCVAL
FT                   VGVAIQASPFSLGQLIAGRVITGLGVGGFTATIPMYVSESSGAEARGRMVLLEGWFAIG
FT                   GIVLATWLEFGLYYVSDNSASWRFPIAFQGLFALVVVGCIMLLPESPRWLARVGRLEEA
FT                   SEVLARMENAPVDSEHVLQELEIIRQSLVIDDSTELAGSSSPFALTKNRHLHRTVIAVG
FT                   VNILAQMTGVNIITFYSDTIFESNLGYSGTLSRIITGCLQIWQFLAAGVAGLLIDRVGR
FT                   RPLLIAAAAGMTLAQACLAGLSSHLENRSAAGASLLFYFVALFCFPIGLFLVPFMYAAE
FT                   IAPLRTRAKVTAMAAAANWLFNFVLAEVSPVGFATIHWRYYIVYACISAFACVSFYFFC
FT                   PETKGRTLEEIDDIFVQSKSAFDTVRIAREMPYQTEILAHVSDTEKGGLEAMQVENASK
FT                   "
     atggccccta agctcaaagg caagtcatta agcctcatca tcggtcttgt tggcgctgtt        60
     ggatttgtac tacagggtta cgatcaggca gttgccaatg gactgttgac actgggctct       120
     ttcatcgctg tcttccctca aatcgatacc gtgcatacca gcggtagtga gaaatcacac       180
     aattctacga ttcaaggcac aacggtcgct atctatgaag ttggatgcgc actgggtgca       240
     ggttcctgtg ccttcctagg tgacaggctt ggtcgtcgca agaccatctt tcttgccggc       300
     tgtgtagcct tagtcggtgt agccattcaa gcgagtccct tctcgcttgg tcagctcatc       360
     gctggcagag ttattaccgg tcttggtgtc ggtggcttta ccgccacaat cccaatgtac       420
     gtctccgagt catctggcgc agaggcccgt ggacgaatgg tcctactgga ggggtggttt       480
     gcaatcggcg gcattgttct cgcaacatgg ttggaatttg gactttacta tgtcagcgac       540
     aactctgcca gctggcgatt tcctattgca ttccaaggcc tcttcgctct cgtggttgtg       600
     gggtgtatca tgcttctacc cgagtctccc cgctggctcg cacgcgtcgg ccgcctagaa       660
     gaggcatctg aggtcttggc ccgcatggaa aatgcgccag tcgactccga gcatgttcta       720
     caggagctgg aaattattcg acagtcactg gtaatagacg atagcaccga attggcaggt       780
     tcctcttcgc catttgctct cacgaagaac cgccacctgc accgtacagt tattgccgtt       840
     ggtgtgaaca ttctggcgca gatgactggt gtcaacatca tcactttcta ttccgatact       900
     atcttcgagt ccaatctggg ttactccggc actctctcac gaattatcac cggttgtctg       960
     caaatctggc aattcttggc ggcaggcgtg gctggtctac tcatcgatcg tgtcggacgt      1020
     cgtccgctgc ttattgctgc cgctgccggt atgacccttg cccaggcttg tctggcaggg      1080
     ctatcaagcc accttgaaaa taggtctgca gctggcgcat cactcttgtt ctacttcgta      1140
     gcgcttttct gcttccctat tgggcttttc cttgtcccat tcatgtacgc tgcggagatc      1200
     gcaccgctgc gcactcgtgc taaggttact gccatggcag ctgcagcaaa ctggctcttt      1260
     aacttcgtgt tggcagaagt gagccctgtg gggttcgcta ctatccactg gcggtattac      1320
     attgtctacg cttgcattag tgcctttgct tgtgtgtctt tctacttctt ctgccctgag      1380
     actaagggcc gtacgctgga ggagatcgat gatatctttg tccagtcgaa gtctgccttc      1440
     gatactgttc gaatcgcacg ggagatgccc taccagacgg agatcctggc gcacgtcagt      1500
     gataccgaga agggtggact ggaggccatg caggtggaga atgcttcaaa atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page