(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE136

PENCW_10.PE136       Location/Qualifiers
FT   CDS_pept        join(complement(316872..316996),complement(316096..316819))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948746"
FT                   /orf_name="Pc13g01360"
FT                   /product="Pc13g01360 protein"
FT                   /protein_id="CAP91205.1"
FT                   /db_xref="UniParc:UPI00018305D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q1"
FT                   /transl_table=1
FT                   /translation="MQHQIQNEARWSNPQLGQLAGDLAAAAASASLVTPAVAIIDRALV
FT                   EQAAFKQPIFCGLRRHALGALRQPGLFVFQRPFGIVWALYAATYSVANVTDTISRKLEI
FT                   TAAGAITFATTMLANVPLALWKDLRFAQEYGTGRGPDAKTSKATTPIPVPLQNKSLART
FT                   AAAIFLVRDGFTIFGSFTLAPWLSDAIPDSLAAHPQAKPIITQLTVPVLTQLVATPLHL
FT                   LALDMYTRQYTMPFLERVKHSQQYLPSSTLLRCVRIIPAFGIGCLTNMELRSAFHAKAS
FT                   G"
     atgcaacacc aaattcagaa tgaagctcgc tggagcaatc ctcaactagg acaactggca        60
     ggcgatctcg ccgcggcagc agcttcggct tcactagtga caccagcggt agcaattatt       120
     gatagagcgc ttgtcgagca agctgccttc aagcaaccca ttttctgtgg acttcgtcgg       180
     catgcgctcg gggccctccg acagccgggc ctgtttgtct tccaacgacc cttcggtatc       240
     gtctgggccc tctatgcggc gacttattcc gtcgcaaacg tgaccgatac aatcagtcgc       300
     aagcttgaga taaccgccgc gggggcgatc acatttgcca cgactatgtt ggctaacgtg       360
     ccgctagcgc tatggaagga cctccgattt gcgcaggaat acggcaccgg caggggtccc       420
     gatgccaaga catcgaaagc aaccacaccg atccctgtac ccctccagaa caagtcattg       480
     gcacgcactg cagctgctat cttcctcgta cgagacggtt tcactatctt tggatcattt       540
     acgttggccc cgtggttgtc ggatgctatc cccgacagct tggcggctca tccccaggcg       600
     aagccgatca tcactcagtt gaccgtgccc gtcttaaccc agctggttgc taccccgctg       660
     catttgttgg cgttggatat gtatacacgg caatatacta tgcctttctt agaaagagtg       720
     aagcattcgc aacaatatct cccctcgtcg actttgttgc gttgtgtccg tatcattcct       780
     gcgtttggaa tcgggtgctt gacgaacatg gagttacgat ctgctttcca tgccaaagcc       840
     tcgggttga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page