(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE137

PENCW_10.PE137       Location/Qualifiers
FT   CDS_pept        join(317309..317449,317500..317972,318029..318978,
FT                   319037..319209)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671903"
FT                   /orf_name="Pc13g01370"
FT                   /product="Pc13g01370 protein"
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAP91206.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00018305D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q2"
FT                   /transl_table=1
FT                   /translation="MSTTLMRLRSARPTGSRLRSVPAGLSIQARAKATMPFRLPDGRNE
FT                   PNPLYKKGSPERAKVEEALTKLRSQLPVRSELFYDGKLQASSKSWDQPLPAEHATTFTN
FT                   YPFATDEQVRSAIELALEAKQSWQDTPFVDRASIFLKAAELVCTKYRYEIIAATMLGQG
FT                   KNIWQGEIDAAAELADFFRLNCNWAAEILEKQPTRGSDGMWSRIDYRPLEGFVYAVSPF
FT                   NFTAIGGNLICGPALMGNVVVWKPSASNVYASSLLYKILLEAGLPPNVIQFVTGDPEAI
FT                   TETVLSHRDFAGLNFIGSSDVFRSLYGKIGQGVAAKKYREFPRFVAETSGKNFHLVHPS
FT                   ADITSAVNHTIRGSFEYQGQKCSATSRLYLPESRAEEFLTQLKAGIKEITIGNPDKDLS
FT                   AFMGPVIHRGSFEKIKSVIDASNKDPSLKLIAGGTYDGSVGYYVHPTVYQADSPDHRLF
FT                   NEEIFGPVLAVHIYKDADWASTLKSVDQNGGGFALTGAVFAKDRIAIRQAEDALRYSAG
FT                   NFYINCKTTAALIGQQSFGGARASGTNDKAGSSDPLRRFVSPRLIKEEFFGQEGFTYPS
FT                   ND"
     atgtctacca cactcatgag acttcgctcg gcaaggccga ctggctcccg cctgcgctcc        60
     gttcccgcag gtctctcgat tcaagctcgt gctaaggcta ccatgccatt ccgcctcccc       120
     gatggtcgaa acgaaccaaa ccctctatac aagaaaggct ccccggagcg cgccaaagtt       180
     gaggaagcat tgaccaagct ccgttctcag ctacccgtgc ggagtgagct cttctatgat       240
     ggaaaactac aagcgagctc caagtcttgg gatcaaccat tgcccgccga acatgccact       300
     accttcacaa actacccgtt tgccaccgat gagcaggtcc gatcagccat tgaactagct       360
     ctggaggcaa agcaaagctg gcaagatacc ccatttgttg atcgggcttc gatcttcctc       420
     aaggctgccg agctggtatg caccaagtac cgatacgaga ttattgcagc tacaatgctt       480
     ggacaaggaa agaacatctg gcaaggagag attgatgctg cggctgaatt agcggatttc       540
     ttccgtctga actgcaactg ggccgctgaa atcttggaga agcagccaac tcgtggcagt       600
     gatggcatgt ggagtcgcat cgactaccgt cctctggagg gcttcgttta cgctgtctcc       660
     ccattcaact tcacagccat cggtggcaac ctgatctgcg gacctgcgct gatgggcaac       720
     gtggtagtgt ggaagccttc cgcatctaat gtctacgcca gctctttgct ctacaagatt       780
     cttttggagg ccggtctccc acccaacgtg atccaatttg tgactggtga ccccgaagcc       840
     attaccgaga ctgtgctctc acaccgcgac tttgccggct tgaacttcat tggctcttcg       900
     gatgtattcc gttccctgta tggcaagatt ggccaaggtg ttgctgcgaa gaaataccgc       960
     gagttccctc gcttcgtggc cgagaccagc gggaagaact tccaccttgt tcacccctcg      1020
     gccgatatca ctagtgcagt caaccacact attcgcggct cattcgaata ccagggtcag      1080
     aagtgctctg ccacttctcg tctctacttg ccggagtctc gtgcagagga gttccttact      1140
     cagttgaagg ctggcatcaa ggagattacc attggaaacc ctgacaagga tctgtcggct      1200
     ttcatgggcc ctgtgatcca ccgtggatca ttcgagaaga tcaagtccgt catcgatgct      1260
     agcaacaagg acccctcgct gaagctgatt gccggtggta cctatgatgg atctgttgga      1320
     tactacgtgc accctactgt gtaccaagcc gattcaccag accaccggct cttcaacgag      1380
     gagatcttcg gccccgtgct tgctgttcac atatacaagg atgccgactg ggcttctact      1440
     ttgaagtctg ttgatcagaa tggaggcggg tttgccttga ctggtgctgt atttgccaag      1500
     gaccgcattg ctatccgcca ggctgaagat gctcttcggt actctgccgg taacttctac      1560
     atcaattgca agacaacggc tgcccttatc ggccagcagt ctttcggtgg tgcgcgtgct      1620
     agcggaacca acgacaaggc tggtagctct gatcctcttc gtcgttttgt tagcccgcgg      1680
     ttgattaagg aggaattctt cggtcaagag ggattcactt accccagcaa cgactaa         1737
//

If you have problems or comments...

PBIL Back to PBIL home page