(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE139

PENCW_10.PE139       Location/Qualifiers
FT   CDS_pept        join(complement(323629..323840),complement(323481..323578),
FT                   complement(323273..323428),complement(322688..323226),
FT                   complement(322367..322637),complement(322141..322313),
FT                   complement(321895..322078),complement(321349..321842))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948748"
FT                   /orf_name="Pc13g01390"
FT                   /product="Pc13g01390 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91208.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018305D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q4"
FT                   /transl_table=1
FT                   /translation="MHTNNLVVHDAGDKRSNVPGHSHAMDAASERLVKMLHVSCLSLIS
FT                   SAYPGLSAKLSCIFDDRDQKILVTKGYIMELQQKIARIEQKEKGQASPFSSNFDTQTID
FT                   PKDRERVPTLERTSTPDDHNEPRELDDLDSELANPLSSGPPAFMSAANGRTFYLGTSSN
FT                   WSFTRRVLSLAHQHLYQDVLPTESLIFDETTYELGWDGLRTTPSLDFPVVPTRDHTMYL
FT                   INAVKFRCGQLYHLFEEDVFMSSLQQFYSGDGQSMTNSLWYIHFLLILAFGKGFVQPKA
FT                   QGRKPPGVSYFVKALQLLPDPTALYRDPTLGTEILCCIALYYQCVDFRTSAHNYIGQAM
FT                   RIAMAQGMHTSMPVEALGHDMVQRSGKIWWTIYILDREMTSLMGLPQSINDRYVQTQLP
FT                   TFADPSETMSLGMHIKLSQIIAEVNSTIYVINGRINRTFLLSTKTALANIAGLADELRE
FT                   SFPLYLDPGSGISRISAYLHLQYHQCIILATRPLLFCFLKIRFESPESCLESLNASRNV
FT                   RNLMQMCLESAQNIISILSSLQGQGLLETFLPFDLESVFVSTIILLMGPAIDPRVLESH
FT                   PNWLEKAYAIFDEMIRDGNQVAKFRRSELQQLHETLLGCISGDQPRQLAVPDFFQQADV
FT                   LPNPASPSVTPIPGAMPQSIRYDDALLRPDTDLDAECDFSTMLTSAEIMAVADSIESYD
FT                   TEWVSNAMVEHSIW"
     atgcatacta acaatttagt tgtgcacgat gccggagaca aaagatcaaa tgttccgggt        60
     cacagccatg cgatggatgc agcaagcgaa aggttagtca aaatgctaca tgtatcctgt       120
     ctttccttga tatcatcggc ttatccggga ttgtctgcaa agctttcttg catattcgac       180
     gaccgtgatc aaaagatcct ggtaacaaaa ggctacatta tggaattgca gcagaagatt       240
     gcgcgtatag agcagaaaga gaagggccaa gcaagccctt ttagttcgaa tttcgatact       300
     cagacaattg atcccaaaga tcgtgaacgt gtacccaccc tggagaggac tagtacacca       360
     gatgaccata atgaacctcg ggagctggat gatctagact ctgagctagc caacccatta       420
     tcgtctggtc ctcctgcttt tatgtctgca gcaaatggcc gcaccttcta ccttggaact       480
     tcatccaact ggtcgttcac tcggcgagtt ctcagcttgg cacatcagca cctttatcag       540
     gatgtactac ccacagaaag tttgatattt gatgaaacga cctatgaact gggatgggac       600
     gggctacgaa caaccccgag cctagatttt ccagttgtcc cgactcgcga ccacaccatg       660
     tatctgatca atgccgtgaa attccgatgc gggcaattgt atcacctctt cgaagaggat       720
     gtgttcatga gctctttgca gcagttttac tcgggagatg ggcaatccat gacaaatagc       780
     ctgtggtaca tccattttct ccttatcctg gcttttggga aaggatttgt ccagcctaag       840
     gctcaaggta gaaagccacc aggggtgtcc tacttcgtca aagctttgca gcttctgcct       900
     gacccgactg ccctgtaccg agatcctacg ctggggacgg aaatcttatg ttgcatcgcc       960
     ttatactacc agtgtgttga ctttcgaaca tccgcacata actacattgg ccaagccatg      1020
     cggatagcta tggcacaagg aatgcacact agtatgccag tcgaagcttt aggacatgac      1080
     atggtccaga gatcgggcaa aatctggtgg acaatttaca ttctggaccg agaaatgaca      1140
     tcgttaatgg gtctgcccca gtctatcaat gaccgatatg tgcaaaccca actccccacc      1200
     tttgcagacc catcagagac aatgtcatta ggcatgcaca tcaagttgtc ccagatcatt      1260
     gccgaggtga atagcacgat atatgttatc aatgggcgca tcaaccggac ttttctactc      1320
     agcactaaaa cagcattggc aaacattgca gggcttgccg atgaacttcg cgagtcattt      1380
     ccgctatact tggacccagg cagcggaatt tctcgaatat cagcatactt acatcttcag      1440
     tatcaccagt gtatcatcct ggccacccga cctctcctat tctgctttct caaaatccgc      1500
     ttcgagtccc cagaaagctg tctagaatcc ctcaacgcat cccgaaatgt ccgaaacctg      1560
     atgcaaatgt gtcttgaatc tgcccagaac ataatcagta ttctctccag tttacagggc      1620
     caaggcctct tagaaacctt cctccccttt gatttggaat cagtcttcgt atccacaatc      1680
     atcctcctga tggggccagc aatcgaccca cgggtgctag aaagccaccc caactggctg      1740
     gagaaagcct acgccatctt cgatgaaatg atcagagatg gaaatcaagt tgctaaattc      1800
     cggcgatccg agctccaaca gctacacgag acattattag gatgtatctc tggtgatcag      1860
     cctcggcagt tagcggtacc tgatttcttc cagcaggctg atgttcttcc taacccggct      1920
     tccccttctg taacaccgat ccctggggct atgcctcaat ctattcgata tgatgatgcg      1980
     ctcctgaggc cggatacgga tttggacgcg gagtgtgact ttagtacgat gctgacttcg      2040
     gctgagatta tggctgttgc ggactcgatt gagagttatg atactgagtg ggtgtctaat      2100
     gccatggtag aacatagtat atggtag                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page