(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE140

PENCW_10.PE140       Location/Qualifiers
FT   CDS_pept        join(complement(325024..325753),complement(324242..324906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948749"
FT                   /orf_name="Pc13g01400"
FT                   /product="Pc13g01400 protein"
FT                   /protein_id="CAP91209.1"
FT                   /db_xref="UniParc:UPI00018305D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q5"
FT                   /transl_table=1
FT                   /translation="MSADLLAEFGQAPAPDNKSGQQPSQYQKNSFFGVDDNVDFFGSSG
FT                   SAQHNKPTHPNPGAVGQFATPAASCQRPSHQGFDLPLNPHSDVLFDAAFDTPASDDDWG
FT                   EFEGPDSNTQHEHSTALQHSMTATSQKPESWQDDPQGIKTIDLLDSLSVQDPVPVVKHP
FT                   SQIAKKEQQLEPTNSRAEPTWDDDSFDDWGDFADAPASQPLPKVSEKKTKPPTKPPTKP
FT                   LVKSNKPPASTWDDDAFDDWGAPAATVRPTNIPPPSVLLELFLDVFENLHKEAALAKSQ
FT                   LRSSAPPSSSSSNTVSTTALNIHNVLQSAARVIAGRSLRWKRDTILSQSMRIGPARSGK
FT                   AGGMKLNSVNKQENIKEEQDAVDVITTWRERAAVFNAVLQAAGLRPIPTVPDASALKVI
FT                   TARADQGALKASHPCALCSLKRDERVLRVDEQNVQDSFGEWWTEHWGHTACRQFWERNR
FT                   NLLGQR"
     atgtccgcag atctactagc agagttcggc caggcacctg caccagacaa taagtccgga        60
     caacagccat cacaatacca gaaaaactca ttcttcggtg tcgacgacaa cgtcgatttc       120
     ttcgggtcat cggggagtgc tcagcacaac aaacctaccc atccaaaccc gggagcagtc       180
     gggcaatttg caactccagc agcttcgtgc cagcgcccta gtcatcaagg atttgacctt       240
     cccttgaatc cacacagcga tgtattattc gatgcagcat ttgacacgcc agcaagtgat       300
     gacgactggg gtgaatttga gggccctgat tcaaataccc aacatgaaca ttcaacagct       360
     cttcagcact caatgacagc cacgtctcaa aaaccagagt cttggcaaga tgatcctcag       420
     ggtatcaaaa caattgactt gctagattca ctctcagtgc aagaccctgt accagttgtg       480
     aaacatccgt cgcaaattgc caaaaaggaa caacaactcg aacctactaa tagccgagcc       540
     gagccgacat gggatgatga ttcctttgat gactggggcg attttgccga tgcgcctgct       600
     agccaacctc tccccaaagt ctctgagaag aaaacaaagc cacctacaaa accacctaca       660
     aaaccactcg tcaagtcaaa taagccgcct gcgtcaacct gggatgacga tgccttcgac       720
     gactggggtg cccccgcggc caccgtccgt ccaacaaaca tcccgccgcc gtcggtactt       780
     ctcgaattat tcttagatgt gtttgagaat cttcataagg aggctgcact cgcaaaatct       840
     cagctgcgat cttcggctcc accgtcgtcc tcatcctcaa acaccgtttc aacgacagcc       900
     ttaaatatac acaatgtact tcaatcggcc gcccgcgtaa ttgcagggcg aagtctccgg       960
     tggaaacgtg atacaatcct tagtcagagc atgcgaatcg gtcctgcccg ttccggcaaa      1020
     gccggtggta tgaaacttaa cagcgtgaac aagcaagaga acatcaaaga agaacaagac      1080
     gctgttgatg tgattactac ttggcgtgaa cgggcggcgg ttttcaatgc ggttctacag      1140
     gcggcaggcc tgcggccaat ccctacggta cctgatgcta gtgcgctcaa ggttattacg      1200
     gcacgggcgg accagggcgc actgaaagcc tcacatccat gtgcactctg ttcgcttaag      1260
     agagacgagc gagtgttacg agtggacgaa caaaatgttc aagatagctt cggagagtgg      1320
     tggactgagc attggggcca cacggcatgc aggcaatttt gggagaggaa tcgaaatctg      1380
     cttgggcagc gttga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page