(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE141

PENCW_10.PE141       Location/Qualifiers
FT   CDS_pept        join(complement(328554..328657),complement(328039..328112),
FT                   complement(326589..327973))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948750"
FT                   /orf_name="Pc13g01410"
FT                   /product="Putative uncharacterized protein Pc13g01410 "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91210.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00018305D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q6"
FT                   /transl_table=1
FT                   /translation="MDLVGLYRKDGITPTTLPNFADLHPKSGTKDLLVIPSEDGWFVSD
FT                   FYLFHYLLSPKFPRPPNQIWLTCEDPSALVRKYHEYLHGNPKGDRRAVLDGERLPNILG
FT                   AGNVRVVPRIDLLERYLSTLREQAAEATRCEEHLVLLFFGHGTPAHGIEVGDSILHMKD
FT                   LRHLLQPMSSTTIFTTSCYSGGWLVCPDINQEQLNTTSITASGKDNESSSWTVSGSAGR
FT                   ASGSLAASAVLRCLIDAEDETQERTEHPTYLELSKSVYDCVKDMVTLGNSQQIYFSAEN
FT                   DEWETSYQPRLGLPLASYKDKWLSLRQVPPSPSPPSSTSSPELAKTGGRRLKRLKYLAE
FT                   EYFAAKPGPNEASPNIGLHNCLRSVLNGATYPKEKVDSLTETTTYRLGAMYEADYLREQ
FT                   IGLKFPSIFSMETPLAQIENESCNPELYTQTWSLLLKRKICTTPIGIRLHFPKPLQYLT
FT                   IALVESSTSWEMIQDQVEAMASKKKAWFRFIYRAWMGNRVAHDEGVMNSRRAFLEACKK
FT                   LKY"
     atggacctag ttggactgta ccgcaaagac ggcattacac caaccacctt gccaaacttc        60
     gctgacctcc atccaaagag cggtacgaag gacctgctcg ttatccctag tgaggacggg       120
     tggtttgtat cagacttcta cctgttccac tatcttctat ccccgaaatt tccgcggccg       180
     cctaaccaaa tatggctgac atgcgaggac ccgtcagccc tcgtcagaaa atatcatgaa       240
     taccttcatg gtaacccaaa aggtgaccgt cgggcggtac tagacggcga gagacttccc       300
     aacatcttag gggctgggaa cgtgcgtgtt gtgccacgaa tagatctcct ggagaggtac       360
     ctcagcacat tacgagagca agcagccgaa gcgacccgct gtgaagagca tctggtcctg       420
     ctttttttcg ggcacggcac cccggcccat gggatagagg tcggagattc tatcctgcat       480
     atgaaagacc tccgccatct actgcaacca atgtcctcca ccaccatctt cactacgtcg       540
     tgctactccg gtggctggct cgtctgcccg gatatcaacc aggagcagct gaacaccaca       600
     tctataacag catcgggcaa ggacaatgaa tcatcatcgt ggaccgtcag cggcagtgct       660
     gggcgcgcta gcggcagctt agccgcctcc gccgttctac gctgtctgat agacgccgag       720
     gacgaaaccc aggagaggac agagcatccc acttaccttg aactttcaaa atcagtatat       780
     gactgcgtga aggacatggt gacactcggt aattcccagc agatctactt ctctgcggaa       840
     aacgacgagt gggagacgag ttaccagcct cgcctcggtc tgcccctggc gtcatataag       900
     gacaaatggc tatctttacg acaggtcccg ccctcccctt cacccccttc ctcgaccagt       960
     agcccggagc tggcgaagac tggcggtcgg cggctcaaac gcctaaagta tctcgcagaa      1020
     gagtactttg ccgcaaagcc cggtccgaac gaagcctctc cgaatattgg cctgcataac      1080
     tgtctgcgat ctgtcctcaa tggtgctacc tacccgaaag aaaaggtaga tagcctgacg      1140
     gaaaccacga cgtacaggct aggggcaatg tacgaagcgg actacttaag ggagcagata      1200
     gggttgaagt tcccctcaat cttcagcatg gagactcccc tggcccaaat tgagaatgag      1260
     tcctgcaacc cggagttgta cacacaaacc tggagtttgc ttctgaagcg gaagatctgc      1320
     acaactccga ttgggatccg cctgcatttc cctaaacccc tccagtacct tacaattgcg      1380
     ctggtggagt catcgacgtc ctgggagatg atccaggacc aggtggaggc tatggcctct      1440
     aagaaaaagg cctggttccg gttcatctac agagcgtgga tgggaaaccg agtggcccat      1500
     gacgaagggg tgatgaatag cagacgagcc ttcctagagg cttgcaaaaa gctcaagtat      1560
     taa                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page