(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE142

PENCW_10.PE142       Location/Qualifiers
FT   CDS_pept        join(329148..329170,329222..329339,329395..329553,
FT                   329619..330136,330191..331613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948751"
FT                   /orf_name="Pc13g01420"
FT                   /product="Pc13g01420 protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91211.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00018305D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q7"
FT                   /transl_table=1
FT                   /translation="MRTIEETRKRWDILFSDNDTPSDLRAALQSEHGGNLCNDGLRSVC
FT                   WKAFLLFDGLDKSEWAPKLDESRDAYRALRDHFLKYIEHPDDLESTVDPLADDEQSPWQ
FT                   TLRHDETLRAEILQDVDRCLQENFFFQEPDTKSKLTDILFVYSKLNPDVGYRQGMHELL
FT                   APILWAVDRDSVKPNLEDLDANKDKSEGLMRKLLDAQFVEHDAFTLFLSVMQTARIYYE
FT                   HGETRSANGQMDVIPIVDRCHYLHKEALTIIDHELAEHLEAVDVLPQIFLTRWMRLLFG
FT                   REVPFDDVLTMWDLLFAHGLRSDLVDFTCIAMLLRIRWQCWSACSIFHRIFIADMHHLV
FT                   LTADYTTALTLLLRYPSPQPHTTQSFVHDALYLEQNPTADRGSFIISKYSGRPPDAKFR
FT                   QQPSTRPTRKAFLWEDFKKRSGSNSPTGSPARNSPNSLESLFQDVSQGIQRRTETWGVA
FT                   KAVRGAVTEARKNMQTMNFDPNMRPVSSRPISAASASDIQSKAPMASTVASARLETKIN
FT                   LLEKRNQALATMLREALDDLGSQLANIKDLGSDTNSAVKQALVKAESVQVCLGDSSIPV
FT                   DPPLDPRVDGELNQLDELQETVTSTMGKEDDNVVANEGQSRTINPVKADTTGPKAESGT
FT                   NPTLDTASRTNSDRKESARAIRSRPTVRPSMTDSGFSWMLGGGRNLSGFVSSTSPPPEQ
FT                   TRHLDQTRGKPKPNALFGLSGDDNLGPDSEHSELALYSLRGSRDPLSGTGPL"
     atgagaacca ttgaggagac cagaaagaga tgggacatcc tgttctccga caatgacaca        60
     ccttccgacc tccgagcggc gttgcaatcc gagcacggag gaaacctgtg caatgacgga       120
     ctgagatcgg tctgctggaa ggcatttctg ctcttcgacg ggttggacaa atctgaatgg       180
     gcccctaagc tcgacgaatc ccgggatgct tatcgtgcgc tacgagatca ttttttgaaa       240
     tacatcgaac atccggacga tctagagtcg actgttgatc cgttagcgga tgatgagcag       300
     tcaccttggc aaacactccg acacgatgag acgctgcgtg ccgagatcct acaagatgtc       360
     gatcgatgct tgcaagagaa cttctttttc caagagcccg acacgaaatc caagttgact       420
     gatatcttgt tcgtctactc gaagctcaat ccggacgtcg gctatagaca aggaatgcac       480
     gaattacttg cgccaatact ctgggcagta gatcgagact cggtgaagcc aaacttggaa       540
     gatctcgatg cgaacaagga caaaagcgag ggtttgatgc gaaagcttct tgatgcacaa       600
     ttcgtggaac atgatgcatt tacgctgttt ctatctgtca tgcagacggc gcgtatatac       660
     tatgaacacg gcgagacacg gtcggcaaat ggccagatgg atgtcattcc gattgttgat       720
     cggtgtcatt acctccataa ggaagccttg acaattatcg atcatgagct cgctgagcac       780
     ctggaagctg tggacgtatt accgcaaatt ttcctaactc gctggatgcg ccttctgttt       840
     gggcgagaag tcccatttga tgatgtcttg accatgtggg atctactatt tgctcatgga       900
     ctgcggtctg atcttgttga tttcacctgc atagcaatgc tgcttagaat tcgttggcaa       960
     tgttggtcgg cctgctcgat cttccatcgt atctttatcg ctgacatgca tcatttagtg      1020
     ctcacggccg actatacaac cgccttaaca ttattacttc gctacccttc accccaacca      1080
     cacaccaccc agagttttgt gcatgatgca ctctatttgg aacagaatcc taccgctgat      1140
     cgaggcagtt tcatcatatc aaaatattca ggtagaccgc ctgatgccaa atttcgccag      1200
     cagcctagta cacggcctac gagaaaggcc ttcctttggg aagacttcaa gaaacgcagt      1260
     ggaagtaact cccctaccgg atcaccagcc cgaaacagcc ccaacagtct cgaatctctt      1320
     ttccaagatg tctcccaggg aatccaacgc cgaacagaga cctggggcgt agccaaagcc      1380
     gttcgaggcg ccgtgacaga agccaggaaa aatatgcaga ccatgaattt tgatccaaat      1440
     atgcgtcctg tctcttcgag gcctatttcc gcggcatcag cctcggatat acaatccaaa      1500
     gcgcccatgg cgtctacagt ggcctcggcc aggctggaaa cgaagatcaa tctactcgag      1560
     aaaaggaacc aggctttggc gacgatgtta cgggaggcac tggatgatct tggctcgcag      1620
     ctggcaaata tcaaggacct cggttctgat acgaacagcg cagtcaagca ggctctggtc      1680
     aaagccgaga gtgtccaggt ctgcctcgga gactcttcca taccagtaga tcctcctctc      1740
     gatccccgtg tagacggtga attgaaccaa ctggacgagt tacaggagac agttacctca      1800
     acgatgggca aagaagacga caacgttgtg gcgaacgagg gtcaatcccg aacaatcaat      1860
     cccgtcaaag cggatacgac cgggccgaaa gccgagagtg gaaccaatcc taccctggac      1920
     acggcaagtc ggacgaacag tgacaggaag gagagtgcac gggcaatacg ctcgcgacca      1980
     actgtacgac cttctatgac ggattcggga ttctcatgga tgcttggcgg tggtcggaac      2040
     ctgtcgggat ttgttagctc gacgtcgccg ccgccggagc agactcgaca tcttgaccaa      2100
     acccggggga agcccaaacc caatgcctta ttcggcctga gcggagatga caatctaggg      2160
     cccgattccg agcatagtga attggcgctg tacagccttc gggggtctcg ggaccctctg      2220
     tcaggaaccg gcccactatg a                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page