(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE143

PENCW_10.PE143       Location/Qualifiers
FT   CDS_pept        join(332793..333062,333092..333261,333323..336288,
FT                   336367..336617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128950"
FT                   /orf_name="Pc13g01430"
FT                   /product="Pc13g01430 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91212.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018305DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q8"
FT                   /transl_table=1
FT                   /translation="MGLGELVEVRSKEPGHHLTRIELTTHRALRKEGLGEQPGRESIFS
FT                   QAITATRQHMPGYASDRRDQLLDHLEASHFLGRPVKWKPRDAPIEVNLADQNLGEPSPL
FT                   SSPLGPLSESPESESGLHHLSLQTDRLRSSAGSVSSGYDPLSRSPLFENDHGIGPSGLD
FT                   RIRHNQPSRVLTLPNMSTSSLSLGPIPSQRPVPSPRSRSSSRAHTGHLSNRSFTDLEDL
FT                   HRFPLESLHSFSFAQQSEEFLHSRQNILKRSIDFMRDRMGWAASNAAIANAQANASGDT
FT                   EMQGMMELLARANMLETQENQIQGRGPITGPAEINGDNIFEKAFSDADSSPVSTRGGVQ
FT                   DSIPSGSHPSDGSQLLSPVPSDSISNQRRDLVSAPTSRRVSLKRTYTDLCSVSVRSKLM
FT                   ETLAQPYTSSADPFASLNSSTAGLGFQIPAPHAHSNKWTPASQAVFRTEAKEPWTILAA
FT                   NDLSCLIFGVLQSEVRRLSILEVVQKEHREWLKAKLRDPSTDAAARMPLQPERANISAV
FT                   NPKFRGLGNGVTAQLLSKPSSREKSRRAQTDDGYGSSTRNTRNNNHPANKSRGVLLCGD
FT                   VVPIQKRNGSRGSASVWVMEKRGGLIWVLEEITENVASIQCDDSWNVVSAKGAVEKIWG
FT                   PSVVQKGQSITDLLPCLPSDSLETSLEKGLAKIVELKHFAARTAAGVCIPVAVGKGEGD
FT                   RTLQVSSFPHVAGMMVLSSSSLNVISSNSVFSSVLFGQQRPEGLHITQLVPDFDEILDV
FT                   LTEEDNVPLVDGIVIPEHSFRRARTLSILRDGKANAASVFTEPSGLLAKHRDGSTIVVD
FT                   IQLRVVKSGTLFSKDKAEKSSDRSSDSDDSDDTIAVTELVYALWITYSRQLHAAGPAAG
FT                   LSPSSVPSSKPTSPTHDPDSVRPSDASAATQTADNSKAYVEIQTPTSTLSQQLSEAASE
FT                   PLAARPAQPVPPVSAANAKNDPPAKRTINDYVILEEMGQGAYGQVKLARLKKQPNKKMV
FT                   LKFVTKKRILVDTWTRDRRLGTVPLEIHVLDFLRRDGLKHPNIVEMEGFFEDDINYYIE
FT                   MTPHGLPGMDLFDYIELKANMDESECQNIFKQVASAVNHLHTKALVVHRDIKDENVVLD
FT                   GEGRIKLIDFGSAAYIKNGPFDVFVGTIVLQGRSYRGKEQDIWALGILLYTIVYKENPF
FT                   YNVDEILDHPLRIPFLPFSEDCIDLIRTMLDRDVDNRLTITEVLEHPWMVGA"
     atgggccttg gggaactagt ggaggtgaga agtaaagaac caggtcatca tctcactcgg        60
     attgagctta cgactcatcg agcactccgg aaagaagggc tcggggagca accagggcgc       120
     gaatcaattt tctcccaggc gatcacagcc acccgccagc acatgcccgg atatgcatct       180
     gaccgcagag atcaactgct tgatcatttg gaagcgtcac atttcctcgg aaggcctgtg       240
     aaatggaaac ctcgagacgc accgatcgag gtgaatctcg ctgatcaaaa cttaggcgag       300
     ccgagtcctc tttcgtcgcc gttaggaccc ctctctgagt cgcccgaatc cgagtccgga       360
     ctgcaccacc tttctttaca gacagaccgc ctcaggagct ccgcgggcag tgtttcttcg       420
     ggatatgacc ctctttccag atctccgtta ttcgagaatg atcatggaat cggtccatct       480
     gggctggatc gtatacgcca caaccaacct tcacgagtac tgacccttcc aaacatgtct       540
     acctcttcgc tatcgctagg tcccatacct agccagcgtc ctgttccctc tccccgctct       600
     cgctcatcat ctcgagcgca caccggtcac ttgtcgaacc gaagtttcac cgatctagaa       660
     gacttgcacc ggtttcccct ggaatcgcta cattcctttt ccttcgccca acagtccgag       720
     gaatttctcc acagccgcca aaacatcctc aagaggtcta ttgatttcat gcgcgaccga       780
     atgggatggg ccgcaagcaa tgccgcgatc gccaatgcac aagcaaacgc cagtggggac       840
     acggagatgc aaggtatgat ggagcttttg gcccgagcaa acatgcttga aacccaggaa       900
     aaccaaatcc aaggccgggg acccattaca ggacccgccg agattaatgg cgacaatatc       960
     tttgagaagg ccttctcgga tgccgattcc tctccggtca gcacccgagg tggcgtccag      1020
     gattccattc cctcggggtc acatccctct gacggctccc aattgttgag cccggtgccc      1080
     agcgatagta tttccaacca aaggcgggac ctggtctctg cacccacgtc caggcgcgta      1140
     agcttaaaac gtacatacac ggacctatgc tctgtctctg tcaggagcaa gctgatggaa      1200
     actctagcac aaccttacac ctcttcggcg gatcctttcg cctcacttaa ctcctcaacc      1260
     gctggattgg gattccagat ccccgcccct cacgcccata gcaacaaatg gaccccggct      1320
     tcccaggccg tgttcaggac cgaagccaag gaaccatgga ccattctggc cgccaatgat      1380
     ctatcatgcc tcatcttcgg ggttcttcaa tccgaagttc gccgtctcag catcctggag      1440
     gttgtacaga aggaacaccg ggaatggctc aaggctaaac ttcgagatcc cagcactgat      1500
     gccgctgccc gcatgccact tcagcctgaa agagctaaca tctccgccgt caaccccaag      1560
     ttccgaggtc ttggcaatgg agttacagca cagcttctca gcaaaccatc gtcacgagaa      1620
     aagtctcgga gagcgcagac tgatgatgga tatggctcca gcacgagaaa cacccgaaac      1680
     aacaaccacc cggccaataa gtcacgcgga gtcttgctgt gcggtgatgt ggtcccaatt      1740
     cagaagcgca acgggtcacg aggatccgct agcgtctggg ttatggaaaa gcgtggtggc      1800
     ctgatctggg tcctggaaga gatcacagag aacgttgcct ccattcagtg cgacgattca      1860
     tggaacgtcg tgagtgccaa aggtgcagtc gaaaagatat ggggcccatc tgtcgtccaa      1920
     aaaggccagt cgatcaccga ccttttaccc tgtttgccat cggattctct tgagacttcc      1980
     ctcgagaagg gactggctaa aatcgtggag ctgaagcact ttgccgcccg caccgcggcg      2040
     ggtgtctgta ttcctgttgc tgtcggcaaa ggagaagggg atcgcactct gcaggtctcc      2100
     agctttcctc atgtcgcagg catgatggtg ctctcgtcct catcattgaa cgtgatcagc      2160
     tccaactctg tgttctcctc ggtcctattc ggtcaacaaa gaccggaggg actccacatc      2220
     acccaacttg tacctgattt cgatgagatt ctagatgttc taaccgagga ggacaatgtg      2280
     ccactggttg atggtattgt catacccgaa cacagcttcc gacgggctcg gacactttcc      2340
     attctccggg atggaaaggc aaatgccgcg tccgtgttta ctgagccaag tggcttgctt      2400
     gcgaaacatc gggacggctc gaccattgtc gtggacatcc aactgcgcgt ggttaagagc      2460
     ggcactttgt tctcaaagga taaggcagag aaaagcagcg atcgcagcag cgactctgat      2520
     gacagtgatg acaccattgc agtcaccgaa ctggtctatg ctttatggat aacgtactca      2580
     aggcagctcc acgctgctgg gcccgctgct ggtctctcgc catcatctgt accaagttct      2640
     aagccgacct cgcccacgca cgatccggat tccgttcgcc cttcagatgc cagcgctgct      2700
     acccagactg cagataatag caaggcttat gtggagatcc agaccccgac atcaacactc      2760
     agtcagcaac tcagtgaggc tgcctctgag cctcttgccg cccgtcctgc gcagcccgtt      2820
     cctccggtgt cggctgccaa tgcgaaaaat gaccctccgg ccaaacgaac gatcaatgac      2880
     tacgtgattc tcgaggagat gggacaggga gcctacggcc aagtcaagtt ggcacgttta      2940
     aagaagcagc ccaacaagaa gatggtattg aagttcgtca ccaagaagcg gatcctggtg      3000
     gatacgtgga ctcgtgatcg gcgactcggt actgtgccac tggagatcca tgttctagac      3060
     ttcctccggc gggatgggct caagcaccct aacattgtgg agatggaagg cttcttcgaa      3120
     gatgatatca actattacat cgaaatgact ccccatgggc ttccgggaat ggacctgttc      3180
     gattatattg agctcaaggc caacatggac gagtcggagt gtcaaaacat cttcaaacag      3240
     gttgcgagcg ccgttaatca tttacacacc aaagcactgg tggtacatcg tgacatcaag      3300
     gatgagaatg tggttcttga tggagaggga cggatcaagc tgatcgactt tgggagtgca      3360
     gcctacatca aaaacgggcc gtttgatgtc tttgtgggaa ctattgtttt acagggcagg      3420
     tcgtatcgag gcaaggaaca ggacatctgg gccctgggaa tcctccttta cacaattgtc      3480
     tacaaagaga accccttcta caacgtcgat gagatcctag accaccccct tcgaatcccc      3540
     ttccttcctt tctcggaaga ttgcattgac ctcatccgca caatgctcga tcgcgacgtt      3600
     gacaaccgtc tcaccattac tgaagtgctt gaacaccctt ggatggtggg ggcttga         3657
//

If you have problems or comments...

PBIL Back to PBIL home page