(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE144

PENCW_10.PE144       Location/Qualifiers
FT   CDS_pept        join(complement(337523..337609),complement(337310..337431),
FT                   complement(337055..337160))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948752"
FT                   /orf_name="Pc13g01440"
FT                   /product="Putative uncharacterized protein Pc13g01440 "
FT                   /protein_id="CAP91213.1"
FT                   /db_xref="UniParc:UPI00018305DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9"
FT                   /transl_table=1
FT                   /translation="MPFSWYFLSASWVTLEYIVQYTLVSVYETNPLKAPIQGHPRGQVP
FT                   ERQVRFIFASFGLPRCPGVFAGGGIIPNCIELERSGEAQLLNLAYKVELGPIVMQTKPH
FT                   "
     atgccgttct cttggtattt tctctctgct tcttgggtaa ccttggagta tattgtacaa        60
     tatactctgg tttccgtgta cgagacgaac ccactcaagg caccgatcca gggacatccc       120
     cgagggcaag ttcctgagag gcaagtcaga ttcattttcg cctcttttgg actgcccagg       180
     tgcccaggtg ttttcgctgg tgggggcata atccccaatt gcattgaatt ggagaggtct       240
     ggagaggccc aacttcttaa cttggcatat aaagtggagc ttggccccat agtgatgcag       300
     actaagccac actag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page