(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE146

PENCW_10.PE146       Location/Qualifiers
FT   CDS_pept        join(complement(344712..345261),complement(343659..344660),
FT                   complement(343512..343604),complement(342185..343461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977832"
FT                   /orf_name="Pc13g01460"
FT                   /product="Pc13g01460 protein"
FT                   /protein_id="CAP91215.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018306A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R1"
FT                   /transl_table=1
FT                   /translation="MESAIRWSPTSSATEQRFLSVDVTGKSFRLCKVTGFDGNYIRHEV
FT                   LSTLSNVPGFRAFDWSTSNENLIAVGQSSGEATILRLDGDAKESLSFPVRNQRYCNAVA
FT                   FSTHGLVASGLDRVRNDFCLNIWDVNQRLSPAGGSRGFTEPLRKLASSEPITSIKFFRD
FT                   QPDTIVTGVKGQFVRIYDLREGPGNPSLQFPTRCVHNLAIDWLDENYIASCIPSNESTI
FT                   CVWDRRVGSRLTSPSMGSSASVADSGQATPALELKNVFHPKSSIWSLRFSRTNRGSLAA
FT                   LSSNGHFKNYDIAKDYLPEEYRSSIDETLGQGSSRNYPESVYTKHVRDVCVPFDNPTRS
FT                   YKEKDRVVCFDSLNLSLSPQPSAIALDGNGQPQIITARPPCAPVDLSSRSVLACGISSS
FT                   DSDVRSIHPLSEHISPISDLIGNIRSRVCSTSQEHGANSNGQLFVSKNLGFEPVPSHEN
FT                   RERVMALGVMGVPLTAKEALTLCTINQSRCKEGYLFDEARNRKVASDDQALQDFWGWVE
FT                   RARVGSSGTSMVVNGLDLNYLGVNSVWNNDLGKGFEQRCISAKKDDAKTVADAVATLAT
FT                   QLNLPETKGCDTAYPDHRRLCLRLCGATQSYRELEESVKNLSSEDQHTKAAALAVFQDE
FT                   PKLAYLGLRSNNPTQAHKLLAMAIAGASKGDNGTDWEDTCAEIAKELTDPYARAILALV
FT                   SKGDWNAVIKETTLPLKYRVEVALRWLPDDELTEYLKDATSQAIRQGDIEGVVLTGLGH
FT                   LAMGLFQSYIGKFNDVQTPVLAMSHTVPRFISNEKHIVQFEAWRETYRRQMNSWKLQLE
FT                   RARFDVGSRRFAVTADGRKLMPPPPQQVSLTCNYCTSPLTQHDASSQISPSTKSAEHVH
FT                   PTTGNPLAPTVMSGTVCPRCGRHMPRCGVCTLWLGSPDPMSRASIAADAEAGSREPTET
FT                   EVMRRFVVFCIHCNHGFHANHASDWFKRHKICPVAECNCICDR"
     atggagtccg ccattcgctg gtccccgacc tcgtcggcca ctgaacaacg cttcctgtcg        60
     gtcgacgtca cgggaaaatc atttcgtcta tgtaaagtga ctggttttga tggtaactat       120
     atacgccacg aagtgctatc taccctttcc aatgtgcctg gtttccgcgc attcgactgg       180
     tctacttcaa atgagaactt gatcgccgtg ggccagtcat ctggggaggc cactatccta       240
     cgccttgatg gggatgccaa ggagtctctt tcattcccag tccgcaacca acggtactgc       300
     aatgcggttg cgtttagtac acacggtctt gtggcatcgg gcctcgatcg cgttcgaaat       360
     gacttttgct tgaacatctg ggatgtcaac cagcgactca gtcctgctgg tggaagtaga       420
     ggatttaccg agcccttgcg aaagctggcg agctcagagc ctatcaccag tatcaagttc       480
     tttcgagacc agcctgatac catcgtaact ggcgtcaaag gccagtttgt tcgcatctat       540
     gatttaagag agggacctgg gaatccatca ttgcaatttc ccactcgatg tgtccataat       600
     ctggctattg attggcttga tgagaactat attgcatctt gcattccatc aaatgaaagc       660
     accatctgcg tgtgggaccg gcgcgttggg tctcgactga catctccatc aatggggtct       720
     tctgccagcg ttgcagactc agggcaagca acgcccgctt tggaacttaa aaatgttttc       780
     catccgaagt cctccatctg gagcttgcgc ttctcaagga cgaaccgagg aagcctcgct       840
     gcgctctcca gcaacggtca tttcaagaat tacgacattg ctaaagacta cttgccggag       900
     gagtatcgct cttcgataga cgagactctt ggtcaggggt cttcgagaaa ttacccagaa       960
     tcggtataca ccaagcatgt gcgggacgta tgcgtaccct ttgataatcc gactcgcagc      1020
     tacaaagaaa aagaccgggt tgtctgtttc gattccctca atcttagctt gtcacctcaa      1080
     ccaagtgcga tcgcactcga cggcaatggg cagccccaga tcatcaccgc gcgaccgccg      1140
     tgcgcaccgg ttgatctatc ttcacggagt gtattagcct gcggcatctc atcgagtgac      1200
     tcagacgtgc gatcgattca cccactgtct gagcacattt cgcccatctc agacctgatc      1260
     gggaacatca gatcacgcgt ctgctcgact tctcaagagc atggggcaaa ctcaaatggc      1320
     caacttttcg tgtcgaagaa ccttggtttc gagcctgtcc caagtcatga gaaccgggag      1380
     cgtgtcatgg ctctcggggt catgggtgtt ccgcttactg cgaaagaagc gctcactcta      1440
     tgcacaatta atcagtcgag gtgcaaagag ggttatctgt tcgatgaggc tcgaaaccga      1500
     aaagtggcct ctgatgatca agctctgcaa gatttctggg gctgggttga acgtgctcga      1560
     gttgggtctt ctgggacatc aatggttgtc aatggcttgg acctgaatta tctaggtgtg      1620
     aacagtgtct ggaataatga cctaggcaaa ggtttcgagc aacgttgtat cagcgctaag      1680
     aaagatgatg ccaaaacagt tgcggatgca gtggcaactt tggcaactca gctaaatctc      1740
     cccgagacaa aaggttgtga caccgcttac cccgatcatc gccgactctg ccttcgtctc      1800
     tgtggtgcga cgcaatctta ccgtgagctg gaggaatcag tgaagaattt atctagcgaa      1860
     gatcagcata ctaaagctgc tgcattggct gtcttccagg atgaacctaa gctggcttat      1920
     ctcggacttc gaagcaacaa ccccacccaa gctcataaat tactggccat ggcgattgcc      1980
     ggtgcctcca agggggacaa cggcacagac tgggaggata cctgtgcaga aatcgccaag      2040
     gagctcaccg atccatacgc tcgagccatc ctagcccttg tgagcaaagg cgactggaac      2100
     gcagttatca aggaaaccac attacctctg aagtatcgtg tagaggtcgc gctgcgctgg      2160
     cttccagatg acgaactaac tgaatatctg aaggatgcta caagccaagc aattcgccag      2220
     ggcgatattg aaggagttgt gctcacgggc ttgggtcatc tggccatggg tctgttccaa      2280
     tcgtatattg ggaaattcaa tgatgtccaa acacccgtgc tagcaatgag ccatacggtg      2340
     ccacggttca ttagcaacga aaaacacatt gtccagttcg aagcctggcg tgagacctac      2400
     cggcgacaaa tgaactcctg gaaactccaa ctcgagcgag cccgattcga cgttggctct      2460
     cgtcgtttcg cggtgactgc agacggtcgc aaactcatgc cgccaccgcc gcagcaagtt      2520
     agcctcacct gtaactactg cacgagtccg ctcacccagc acgacgcttc ttcccagatc      2580
     tccccgtcta ccaagagtgc ggaacatgtc catcccacca cgggcaaccc gctggcaccc      2640
     accgtcatgt ctgggactgt gtgtccgcgg tgtggtcgac atatgccgcg ctgcggcgtg      2700
     tgcaccttgt ggctcggctc accagaccca atgtcacgcg ccagtattgc agccgatgcc      2760
     gaggcgggtt cgcgcgaacc tactgagact gaggtgatgc ggcggtttgt ggtgttttgt      2820
     atccattgca accatggatt tcatgcgaat catgcgagcg actggtttaa gcggcataag      2880
     atctgtcccg tggcagagtg caactgcatc tgtgatcggt ga                         2922
//

If you have problems or comments...

PBIL Back to PBIL home page