(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE147

PENCW_10.PE147       Location/Qualifiers
FT   CDS_pept        join(345529..345943,346009..346589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977833"
FT                   /orf_name="Pc13g01470"
FT                   /product="Pc13g01470 protein"
FT                   /protein_id="CAP91216.1"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI00018306A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R2"
FT                   /transl_table=1
FT                   /translation="MSTDTRNQIDQSAPSKRKTRDGSEEVPPARKKVHRKANKADDQAQ
FT                   FVDFSKGDAAKPKVTRQFKDKFAPKPEKEYPSINDLKKRIRDVKRLLNKVDLPADARIL
FT                   QERALAGYEQDLADETARRERSSLIKKYHFVRFLDRKTATKELNRLTRREKEDLDSKQK
FT                   ARLAAKIHNCRVNLNYTIYYPLTEKYIALYPNGKHDTTDPESELQKQETKSNDAKPPLW
FT                   SVVEKCMEEKTLDLLREGKLYINANGEKIQSSSSGATTAANSQKEQSKKKEQKKETKAA
FT                   TQKDKYVSKDDKKSSKKEKTARNEKASKQHEASQQPNAEDEDDSDGGFFE"
     atgtctacag acacgcgaaa ccaaatcgat cagtcggccc cctcaaagag gaagacccgg        60
     gatgggtcag aggaggttcc cccggcccgc aagaaggtgc accgcaaggc aaacaaagca       120
     gatgaccaag cccaattcgt ggacttcagc aaaggcgatg cagcgaagcc caaagtaact       180
     cggcaattca aggacaaatt cgctcccaag cccgaaaagg aatacccgtc gatcaacgat       240
     ctcaaaaagc gaatccgcga tgtgaagcgc ctactcaaca aagtggactt gcctgccgat       300
     gctcgcatct tgcaggaacg tgctctcgct ggatatgagc aagatcttgc agatgaaact       360
     gcgcgcagag aacggtcatc attgatcaag aaataccact ttgtccgatt ccttgaccga       420
     aaaacagcca ccaaggaact caaccgactt actcgccgtg agaaagaaga tctggattcg       480
     aaacaaaagg ctcgtcttgc ggcaaagatc cacaattgcc gtgtgaacct caactacacg       540
     atctattatc ctctcaccga gaaatacatt gcactctacc ccaatggaaa acacgataca       600
     acagatccag agtcagaatt gcaaaagcag gagactaaat ccaatgatgc caaacccccg       660
     ttgtggtctg tcgttgagaa gtgtatggag gaaaagacac tggaccttct tcgtgaagga       720
     aaactgtaca ttaacgccaa tggagagaag atccagtctt cgtcttctgg cgcaactaca       780
     gctgcaaact cccagaagga gcagagcaag aagaaagagc aaaagaaaga gaccaaggct       840
     gctacccaga aggacaagta tgtttctaaa gatgacaaga agagcagcaa gaaagagaaa       900
     actgcacgca acgagaaggc ctccaagcaa cacgaggcat cgcaacagcc caacgcggag       960
     gacgaagatg atagcgatgg tggtttcttt gagtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page