(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE148

PENCW_10.PE148       Location/Qualifiers
FT   CDS_pept        complement(347926..349626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948754"
FT                   /orf_name="Pc13g01480"
FT                   /product="Putative uncharacterized protein Pc13g01480 "
FT                   /protein_id="CAP91217.1"
FT                   /db_xref="UniParc:UPI00018306A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R3"
FT                   /transl_table=1
FT                   /translation="MACTVSGETAFIKQQEILRDRCSKALADHLKENPDVVWTPKDGRG
FT                   ERPSSSEEAAKLKLVVDVEFDEETGQPDFPPGNNRLSDELVYLVTKFMNARDLGRRYPY
FT                   DFDKMGNINPQRVPSGPAPIIWAHGLPFFPVYKGYYILCGRAHAGCIGWLLHEKTGEIM
FT                   QANPIWSVGAVVAPDSAVKAPRNITRQMTQHKPSGSEKNPGYRGKAWARDVVAAEHHLC
FT                   AVFPNLDSDEIEVCPMWNSWGYNVRCGPMRSGVKPTTMPKDFFTSHGIKNIDYESLARP
FT                   YGNHLMDEDEDSDDKDDPDGDVEVIDRAGESVEDASGSNQPIMTQSASQMDVDMNLVSL
FT                   LEVTKQVPAQSPGQHQEQVPEEQDAVRAPVQSPAAAAEKIKEGVKENVKEEAKEEVNEE
FT                   AMEKAIEVPVKQVTEETAKDSEIAPSDLEEKQLAVSNSTVDTELAMMTNIGDSIEQSNE
FT                   NPAPEQTSTAPVLLAETTIQATAIVQPIEVQPKIKQSEIEHAVTGTSDDNTHTIEPLKV
FT                   EQIAPDQPGTEQLDQTAASVLPEDLKVAGVPASNKTDASRSQAPAEVPM"
     atggcttgca ccgtctcggg tgaaacagcc ttcattaagc agcaggaaat ccttcgagat        60
     cgctgctcaa aagccctcgc ggaccacctg aaagaaaatc ctgatgttgt atggacaccc       120
     aaagatggcc gtggagagcg tccaagctcg tcggaagaag cggcaaagct caaactggtc       180
     gtggatgtcg aattcgacga agaaaccggc cagccagatt tccctccggg taacaacaga       240
     ctgtcagatg agttggttta tctggtgacc aagttcatga acgcccgcga tctgggacga       300
     cgatatccat atgatttcga caaaatggga aatattaacc ctcaacgcgt gccttcggga       360
     cccgctccaa ttatctgggc tcatggacta cctttcttcc cagtgtacaa agggtattac       420
     atcctctgtg gacgtgcaca cgccggttgc attggctggt tgctccatga gaaaacgggc       480
     gagattatgc aagccaatcc gatctggtct gttggggcgg tcgtcgcacc tgactctgct       540
     gtaaaagctc ctcggaatat cactcgtcag atgacacagc acaagccttc tggctccgaa       600
     aaaaacccgg gttacagggg caaagcctgg gctcgtgatg ttgtggctgc tgagcaccat       660
     ctctgcgcgg tttttccgaa cctggacagt gacgagatag aggtatgccc gatgtggaac       720
     tcttggggct acaatgttcg ctgtgggcct atgaggagtg gcgtgaaacc aactacaatg       780
     ccgaaggatt tcttcaccag ccatggtatc aagaatatcg actatgaatc tctcgctaga       840
     ccatacggca accacctgat ggacgaggat gaagattcag atgataaaga cgatccagat       900
     ggtgacgttg aggttataga tcgcgctgga gagagtgtcg aagatgctag cggtagcaat       960
     caacccatca tgacccagtc cgcgtcccaa atggatgtag atatgaacct cgtcagcttg      1020
     ctggaagtta caaagcaggt tccagcgcaa agcccaggac aacatcaaga acaggtgcca      1080
     gaagagcagg atgcagtgcg agctccagtg cagtctccag cggcggcggc ggaaaagatc      1140
     aaagaaggag tcaaagaaaa tgtcaaagaa gaggccaaag aagaggtcaa cgaagaggcc      1200
     atggagaagg ccatagaagt ccctgtgaaa caggtcactg aagagactgc caaagattcc      1260
     gaaatcgccc cctcggacct tgaggagaaa caacttgctg tttccaacag tactgtagac      1320
     actgagcttg ctatgatgac gaacatcggg gattcgattg aacaatcaaa tgagaatcct      1380
     gcccccgagc aaaccagcac agctcctgtc cttctagcgg agactacgat acaagccact      1440
     gcaattgttc aacctatcga ggtgcaaccg aagatcaagc agtcggaaat cgaacacgcc      1500
     gtgactggta catctgatga caacactcac actattgagc cgctcaaggt ggagcaaatt      1560
     gcacccgacc agcccggtac tgagcagctg gatcaaacag cagcttctgt cttgcctgag      1620
     gatttgaaag ttgcaggagt tcctgcgtct aacaagactg acgccagcag gagccaagca      1680
     ccagcagagg ttcctatgta g                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page