(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE149

PENCW_10.PE149       Location/Qualifiers
FT   CDS_pept        join(351510..351668,351725..352594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824606"
FT                   /orf_name="Pc13g01490"
FT                   /product="Pc13g01490 protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="CAP91218.1"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI00018306AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R4"
FT                   /transl_table=1
FT                   /translation="MDHPKNNKDKRGRGQGQSRDVQVSKALSLLLRHAAEKEGLKMNTQ
FT                   GYASVSDVLNWRKLKSLKVTFPEILHAVDSSDKKRFALLHIPSAQPTKSTTQATTTPAT
FT                   SPDAEHEAGSIVGEEQPATSVLESAPTTSEAQQSATDQALSVKDTDPSNFLIRATQGHS
FT                   IKTVDAASFLEPLSLSDESKLPDTVVHGTFHATWPAILQSGGLRCMGRNHVHFATGPSL
FT                   ESVLAVNAEDAARSKPKPDDSRVISGMRRDAQVLIYIDVRKALKAGVPFWRSENGVILS
FT                   EGIPVTKGEAEKGEAQKFVTLDFFDVVVERKVGLGKIWEHGEVLQGLPETLTNKGNPKG
FT                   RR"
     atggatcacc cgaaaaacaa caaagataag cggggacgtg gccaaggaca aagtcgcgat        60
     gttcaagtct ccaaagcatt aagcttgctt ctgcgacatg ccgctgagaa ggaagggctg       120
     aagatgaata cgcagggtta tgcgagcgtg tcggacgtgt taaattggag gaaactcaaa       180
     tcgctaaaag tcaccttccc cgagatccta cacgccgtcg actcgtccga taaaaagcgc       240
     ttcgccctcc tccacattcc atccgcacaa cccaccaaat ccacaaccca agcaacaaca       300
     acaccagcga cgtcccccga tgcagagcac gaagccggct ctatcgtggg cgaagagcag       360
     cccgcgacat ccgtcctgga atccgcaccc accacaagcg aagcccaaca atcagccacc       420
     gaccaagcat tatccgtgaa agataccgac ccgtcgaact ttttaattcg cgcgacccaa       480
     ggccacagca tcaagaccgt agatgcggcc tctttcctcg agccgctttc tttgtccgat       540
     gaatcgaaac tgcccgatac tgtcgtccac ggcacgttcc acgcgacctg gcctgcgatt       600
     ctacaatccg gcggactacg ctgcatgggt cggaatcacg ttcacttcgc tactggcccg       660
     tcattagagt ccgtgcttgc tgtcaacgct gaagatgccg cgcggagcaa accgaagccc       720
     gacgactccc gcgtcatctc gggcatgcgg cgggatgcgc aggtattgat ttatatcgat       780
     gtgcgcaaag cactaaaggc aggagtaccg ttctggcgca gtgagaacgg ggtcattctt       840
     agtgagggca tacctgtcac gaagggtgag gctgaaaagg gcgaggcgca gaagttcgtc       900
     accttggact ttttcgatgt ggtagtggag cgcaaggttg ggctgggtaa gatttgggag       960
     catggggagg ttctgcaggg actcccggag actctcacga acaaaggaaa tcccaaaggc      1020
     cggcgatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page