(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE15

PENCW_10.PE15        Location/Qualifiers
FT   CDS_pept        join(34416..34608,34783..34985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671647"
FT                   /orf_name="Pc13g00150"
FT                   /product="Pc13g00150 protein"
FT                   /protein_id="CAP91084.1"
FT                   /db_xref="UniParc:UPI0001830D01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G4"
FT                   /transl_table=1
FT                   /translation="MPPFILSKMPLKAVEHPSADDASSIYSRSPESPKDMLSSMPMMLP
FT                   PRHDLPEINSLDHQIALARVIDVSQELTLQYHFEPEARPLDNERVFQAVRKLRVALEQS
FT                   RIREAQAEQIWKRQWKVSRINHTTRWI"
     atgccgccat tcatactgtc caaaatgcca ttgaaagcgg ttgagcatcc gtctgcagat        60
     gatgcctcaa gtatttacag tcgctcaccg gaatctccga aagacatgtt gagttccatg       120
     ccaatgatgc ttcctcctcg gcatgaccta ccagaaataa attctctgga tcatcagatt       180
     gcactggccc gagttattga tgtttcccaa gagttgacgt tgcagtatca cttcgagcca       240
     gaggcaagac cgcttgacaa tgaacgggtg tttcaagcag tccgcaaact tcgtgttgct       300
     cttgagcaat ccagaattcg agaagcccag gctgagcaga tttggaaacg acagtggaaa       360
     gtctcacgaa ttaatcatac cacacgctgg atctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page