(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE150

PENCW_10.PE150       Location/Qualifiers
FT   CDS_pept        join(353298..353545,353612..354044,354099..354299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948755"
FT                   /orf_name="Pc13g01500"
FT                   /product="Pc13g01500 protein"
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91219.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI00018306AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R5"
FT                   /transl_table=1
FT                   /translation="MATHRFDPTFTDNVINAMGPKTTPRVRKLMAGLIRHMHDYAREEE
FT                   LTVDEWMAGVQMLNWAGQMSDDKRNEGQLVCDVLGLESLVDEITFTLAGEAQDAPTATA
FT                   ILGPFFRADTPYRENGEDIVKTKPADAEMAFMHGRVMDFQTKQPLVGATVEVWQASTNG
FT                   LYEQQDPEQVEFNLRGKFKTDEDGRYSFYCLRPTPYPVPNDGPGGKLLELMDRHPFRPA
FT                   HIHIIATYDNYRPLTTQIFDRKDKYLDNDSVFAVKDSLVVDFVPRKDDPKAAIELEYDV
FT                   KLVKFEASTGGA"
     atggcgacgc accgcttcga tcccaccttc acagacaatg tcatcaacgc gatgggtccc        60
     aagaccaccc cgcgcgtgcg gaagctcatg gcaggtctaa tcagacacat gcacgactat       120
     gcgcgcgagg aggaactcac cgtcgacgaa tggatggccg gcgtgcagat gctcaattgg       180
     gcgggacaga tgagcgacga caagcggaac gagggacagc tggtgtgcga tgtactaggg       240
     ctggaatccc tcgtcgacga aatcaccttc actctcgccg gagaagcgca ggatgcaccc       300
     acagccacgg ccatcctagg cccgttcttc cgcgccgata cgccgtaccg cgagaacgga       360
     gaggacatcg tcaagactaa acctgctgat gcggagatgg cgttcatgca cggtcgcgtc       420
     atggatttcc agaccaagca gcctcttgtc ggtgcgacgg ttgaggtgtg gcaggcttct       480
     acgaacggct tgtatgagca gcaggatccc gagcaggttg agtttaacct gcgcggcaag       540
     tttaagacgg atgaggatgg cagatactcg ttttactgtc tgcgtccgac gccgtacccc       600
     gttcctaacg atggtcctgg aggaaagctc cttgagctga tggatcgtca ccctttccgt       660
     cctgctcata ttcacattat tgctacctat gataactacc gtcctttgac aacgcagatc       720
     ttcgaccgca aggataagta ccttgacaac gactctgtgt ttgctgtcaa ggactcgctt       780
     gtcgtggatt tcgtgccgcg caaggacgat cccaaagctg ccattgagct cgagtacgat       840
     gtgaagttag tgaagttcga ggccagtacc ggtggcgcat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page