(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE151

PENCW_10.PE151       Location/Qualifiers
FT   CDS_pept        join(complement(354910..355345),complement(354440..354816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671904"
FT                   /orf_name="Pc13g01510"
FT                   /product="Pc13g01510 protein"
FT                   /protein_id="CAP91220.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00018306AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R6"
FT                   /transl_table=1
FT                   /translation="MPFVQANSHRLNYADSHPDGPPTPNSLTFFFIHGLGSSQNYYYPV
FT                   IPHLTKLHRCITLDTYGSARSPYTDETVTLPGIAEDVIGVMDTLHIQKAVVVGHSMGGI
FT                   VVTELGARCPERIQGVVAIGPTHPSDTLVTVMNKRSETVLESGIEPMANTIPFGAVGSR
FT                   STPLQKAFIRELILGQDPKGYAALCRAIATAKPADYAAVKAPFLLIAGDEDKSASMEGC
FT                   QHIFHHISSEQKSLEVLKRVGHWHCIEAADEVGGLIAKFGDVLKAVNA"
     atgccattcg tccaagcaaa cagccaccgt ctcaactatg ccgactccca ccccgacggg        60
     cctccaaccc caaacagcct gaccttcttc ttcatccacg gcctgggctc ttcacaaaac       120
     tattactacc cagtaatccc gcaccttacc aaactccacc gctgtatcac acttgacaca       180
     tacggctccg cccgctcccc gtacaccgac gagacagtca cgctaccggg catcgccgag       240
     gatgtcattg gcgtgatgga cacgctgcac atccaaaagg ccgtcgtagt cggtcattca       300
     atgggcggga ttgtagtgac agagctaggc gcgcggtgtc cggagcgcat acagggcgtt       360
     gtagccattg ggccgacgca tccgtcggat accttggtga cggtcatgaa taagagatcg       420
     gagactgttc ttgagtctgg aatcgaacct atggcaaata ccatcccctt tggagctgtc       480
     ggttcgcgca gcaccccgct tcaaaaggct ttcatccggg agttgatcct gggacaggat       540
     cctaagggtt atgccgcgct gtgtcgcgct attgctacag cgaagccggc agactatgcc       600
     gctgtcaagg cgcctttcct gcttattgcg ggtgatgagg acaagtccgc ttctatggag       660
     gggtgccagc atatcttcca tcatatctcg agtgagcaga agtccctcga ggttttgaag       720
     agggttggac attggcattg tattgaggct gctgatgagg tgggtggatt aattgccaag       780
     tttggggatg ttctgaaagc tgtgaatgct tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page