(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE154

PENCW_10.PE154       Location/Qualifiers
FT   CDS_pept        join(358980..359057,359124..359612,359680..360324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948757"
FT                   /orf_name="Pc13g01540"
FT                   /product="Pc13g01540 protein"
FT                   /biological_process="translation"
FT                   /protein_id="CAP91223.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI00018306AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P1"
FT                   /transl_table=1
FT                   /translation="MRCIKNKIEHNGSGAVTLCPEEPEDMWHAYNLIRPDDILRASAIR
FT                   RVTTVQDTGSTSSARVHLNLVIRVKNLDFDPQSSQLHVSGQIINETPHTKIGQFHTLDL
FT                   ELNRNFTLEKEIGAGGEGVGWDSIAIESLKDAVDEGGKRRAEAVAVVMQEGLAHICFIG
FT                   QFQTILKQKIEMSVPRKRQGGGDHDKGMNKFFKVTLETLIRQMEFNTSLTSGANNEAVR
FT                   PVLLASPGFVASGFQKYIQSEASTTTPGLKRLLPSLVVVHSASGYTNSLSEVLQSPAVK
FT                   RLLADTKYARETKLMDDFLEQLRKETNKATYGPREVEDAVEQGAVGRGGGVLIVSNRLF
FT                   RSQDVAERKRWVALVDRVRDVEGGDVRILSSDHESGKRLEGLGGIAALLTFPVIEPDLD
FT                   SDAE"
     atgcgctgta tcaagaataa aattgagcac aatggctccg gggcggtgac attgtgccca        60
     gaagagccag aagacatgtg gcacgcatac aacctgatcc gaccagatga tatccttcga       120
     gctagcgcaa ttcgtcgagt taccacagtt caagataccg ggtccacgag ctcggcacgc       180
     gttcacctga acctcgtaat tcgcgtgaag aatctcgact ttgacccgca gagctctcag       240
     cttcatgtat caggacaaat catcaatgaa accccgcaca caaagattgg acagttccat       300
     actctcgacc tagagttgaa tcgcaatttc acgttagaga aagagattgg ggcaggtgga       360
     gaaggtgttg ggtgggacag tattgcaatt gagtcactca aggacgctgt ggatgagggc       420
     ggaaagcgcc gtgcagaggc tgtggcagta gtgatgcagg aagggttggc tcatatctgc       480
     tttatcggcc aattccagac aatattgaag caaaagatcg agatgtcagt accacggaaa       540
     cggcagggag gaggggatca tgataaagga atgaacaagt ttttcaaagt cacactcgaa       600
     accctcattc ggcaaatgga gttcaacacc agccttactt caggcgccaa caatgaggcc       660
     gtacggcccg tgcttctcgc ctcgcccggg tttgtcgcct ccggcttcca aaaatacata       720
     cagtctgagg cgtcaacaac gactcctgga ctcaagcgac ttttacctag tcttgtggtt       780
     gtacactccg catcggggta cacgaattcc ctatcagagg ttctgcagtc acccgcagtt       840
     aagaggctcc tggctgatac caagtatgcc cgggaaacca aattgatgga cgacttccta       900
     gaacaactac gcaaggagac caacaaggca acctatggtc ctcgcgaggt tgaggacgcg       960
     gttgaacaag gtgctgtcgg ccgaggaggc ggcgtgctca ttgtctcgaa tcgcttgttt      1020
     cgatcacagg atgtcgccga gcgtaaacgc tgggtggcgc ttgtggatcg cgtccgcgat      1080
     gttgagggtg gtgacgtgcg gattctcagc tcggatcatg aaagtggaaa gcgtctcgag      1140
     ggactgggtg gcatcgctgc gcttttgaca ttccctgtta ttgagccgga ccttgactct      1200
     gatgcagaat ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page