(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE155

PENCW_10.PE155       Location/Qualifiers
FT   CDS_pept        join(complement(362106..362344),complement(361079..362027))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977834"
FT                   /orf_name="Pc13g01550"
FT                   /product="Pc13g01550 protein"
FT                   /protein_id="CAP91224.1"
FT                   /db_xref="UniParc:UPI00018306B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P2"
FT                   /transl_table=1
FT                   /translation="MSIILEDNQPPGFLRLGPTWYHEIPFLPHGWETTNDRGCGSLKHA
FT                   AMKAMLRDQSALKPELFEYVHWYMAEYLWDALKRCNKQTMHMWKIMASVYPVQFYKVSP
FT                   YYCLSAGCPKKPLRDYMGILNSEDFRWRAILTIATTYCTATDLTTIPNIKNLVALDVHN
FT                   EPYTSNNAPLHPVGVNNDGLLLQDGFVRGWIESKALRHLRILRFYHQHEMTVASLAALR
FT                   ELPELQLVVAYECKKITETIQKYDKPANGVIPVKGWSACRLDWFWENHGTSKTIDDNLL
FT                   ALHHVYQSSLQTPGEDSRRPSSLPTNLPILEFKLPTVDHSKRDRVVVRSRYNAKSIVLF
FT                   TRDPVKQKLDIKKQQRAREKKKRTEPPEKGDHPAKRAVMKERGPMDISETLNQFF"
     atgtccatca tccttgaaga caaccagccc ccagggttct tacgcctcgg tccaacatgg        60
     tatcatgaga tccctttttt acctcatgga tgggagacaa ccaatgatag aggatgtgga       120
     tcactcaagc atgcagcaat gaaagcaatg ctgcgggacc agtcggcact caagcctgag       180
     ttattcgaat acgtccactg gtatatggca gaatatcttt gggatgccct gaaaagatgc       240
     aacaagcaga caatgcatat gtggaagata atggccagcg tttatcccgt acaattctac       300
     aaggttagcc cttactactg cctcagtgct ggctgtccca aaaagccact gagagactac       360
     atgggtattc tcaatagcga agattttcgc tggcgcgcaa tcttgacgat tgcaaccaca       420
     tactgcactg ccacagacct gaccactata ccaaacatca agaatctggt tgccctagac       480
     gttcacaacg agccatacac gtcgaataac gccccgctgc accccgtggg cgttaacaac       540
     gacggtctcc tattgcaaga tggatttgtg cgtggttgga ttgaatccaa agcactacgg       600
     cacctccgca ttctcagatt ctaccaccag cacgaaatga ccgttgcatc actggcagct       660
     ctgcgtgaac tacccgagct tcagcttgtc gttgcatacg agtgtaagaa gatcacagag       720
     acgattcaga aatatgataa gcccgcgaat ggcgtcattc ccgtaaaagg atggtctgcc       780
     tgcaggctcg attggttttg ggaaaaccac ggaacatcaa aaacaattga tgataatctt       840
     ttggctttgc atcatgtgta tcagtctagt ctccagacac ccggagaaga ttccagaaga       900
     ccatcatccc taccaacaaa tctcccgatt ttggagttca aattaccaac cgtcgaccac       960
     agtaaaagag acagggtcgt tgttcgctcc cgctacaatg caaaatcaat tgtattgttt      1020
     actcgagatc ccgtgaagca aaagcttgat atcaagaagc agcaacgtgc aagggagaag      1080
     aagaagagaa ccgagccacc tgaaaagggg gaccatcctg ccaaaagagc agtcatgaaa      1140
     gagaggggac caatggacat ctcggagact ttgaatcagt ttttttga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page