(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE156

PENCW_10.PE156       Location/Qualifiers
FT   CDS_pept        join(complement(365274..365901),complement(363998..365220))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128952"
FT                   /orf_name="Pc13g01560"
FT                   /product="Pc13g01560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91225.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018306B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P3"
FT                   /transl_table=1
FT                   /translation="MQSFLQHRVLRRKLEQQFVTKHEKPENVWTHEGQYGYREGEIYTH
FT                   PRERSDDLAAERRREHGRRTFISGPSLQPRHSAASHLGREGDIEGAEYDPDLSTDPHTI
FT                   NSAETLGNTPDIMVTGVERPRPGFSTDSESDIESVKRNKLVVVTFEGEDDEMDPHNWTL
FT                   RRRMLVTLLTALMGCVIFWSSTIDTTALPKTRKVYHTSFEVQTLPTAMFLIGCGVGALI
FT                   TAPISEVIGRNPVYIPTMIGFMLFNTGAGLAQTIVQRVVCRGLAGFFGSAPAVLSAATL
FT                   VDVWSRIERVYAFPIYSIIIFIGPIVGPTPGSFAVDAESVSWRWVDWMTIIFAGLVLIP
FT                   VVLFLPESYSPILLYWKAQELRRLTGDDRYRSPLEFRKATFAHRLRASLYRPLLLFATE
FT                   PIILIHSVYLTVLFMILYTFLAGYVSIYHMASHFSPTSTALAFLGILVGVLLSLLILPI
FT                   SMWLLRREIYRSRRRGEHRPDPEISLYMAMFGAPAVPISLFWMGWTAELEFSYWSPLVA
FT                   SVFYGFGTVCIFVSGYQYVSDAFESHATSALSSLQMTRLVGAGAMVIVAEIMYTNLGVG
FT                   WTLTLWGCLSALFTPVPYLLYWRGYNLRQRSWYARRHEHD"
     atgcagtcat ttctccagca ccgcgtcctc cgcagaaagc tcgagcaaca atttgttaca        60
     aagcatgaga agcccgagaa tgtctggacc catgagggcc agtacggtta ccgtgaagga       120
     gagatctaca cgcatccccg ggagcggagt gatgacttgg ctgccgaacg aaggagggag       180
     catggccgtc gtactttcat atctggaccg tctcttcaac ctcgccattc cgctgcatca       240
     catctggggc gggaaggaga tatcgagggc gcggagtatg atccggacct ctcaaccgat       300
     ccgcatacca tcaattcagc agagacactg ggaaacacgc ctgatattat ggtgactggc       360
     gttgaaaggc cccggcccgg gttttcgaca gatagtgagt ctgacattga gtccgtgaaa       420
     aggaataaac tcgttgtcgt cacgttcgaa ggagaggatg acgaaatgga tcctcacaac       480
     tggacactaa gacgtcgaat gttggtgact cttctcactg cacttatggg gtgtgtgatc       540
     ttctggtcat ccacaattga tacaactgct ctcccaaaaa ccagaaaagt gtatcatacc       600
     agctttgaag tccagacttt gccaactgcc atgttcctaa ttggttgtgg agtaggcgcg       660
     ttgataacag cgcctatatc agaagtcatc ggacgcaacc ctgtgtacat ccccaccatg       720
     atcggattca tgttgttcaa cacgggggca gggcttgccc agacaatagt acagcgagtt       780
     gtgtgccgcg gtctagctgg attcttcggg tctgccccgg cagttctatc ggcagcaacc       840
     ctggtggacg tctggtcgcg cattgaacga gtctacgcct ttccgatata ttctataatc       900
     atcttcatag gtccaatagt gggaccaaca ccgggatcgt tcgccgtcga tgctgaatcg       960
     gtaagctggc gttgggtgga ctggatgacc ataatcttcg caggactcgt cctgatcccg      1020
     gttgtgctct ttctgcccga gtcatacagt ccgatcctac tgtactggaa agcacaagaa      1080
     ctccgccgcc taacaggcga cgaccggtac cggtctccgt tagagttcag aaaagccacc      1140
     ttcgcccacc ggctgcgtgc ctcactatat cgaccacttc tgctttttgc aacggagcca      1200
     atcatcttga tccattcggt ctacctcaca gtcctgttca tgatcctgta caccttcctc      1260
     gcgggctacg tctccatcta tcatatggca agccacttca gtccgacctc cactgccctc      1320
     gcattcctag gcattttggt cggagtcctg ctttctctac tgatacttcc gatttcaatg      1380
     tggctcctcc gtagagagat ctaccgcagc cgcaggaggg gcgaacaccg cccggacccg      1440
     gagatcagtc tgtacatggc tatgttcggt gcacctgctg tccccatctc gctgttctgg      1500
     atgggctgga cggccgaact tgaattctcc tactggagcc cgctcgtcgc ttcggtattt      1560
     tatggctttg ggaccgtgtg tatcttcgtc tcggggtacc agtacgtctc tgatgcgttc      1620
     gagtcacatg ctacaagcgc gctttcctct cttcagatga cgcggcttgt tggtgccggc      1680
     gctatggtta ttgtcgcgga aattatgtat actaatcttg gcgttggatg gacattgact      1740
     ctttggggtt gcctttcggc gttgtttacg cctgtgcctt atttgctcta ttggagggga      1800
     tataacctcc gccagcggag ttggtacgca cgcaggcatg aacacgactg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page